SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024R539 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024R539
Domain Number 1 Region: 153-284
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.75e-22
Family UBX domain 0.015
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily UBA-like 8.62e-17
Family UBA domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024R539
Sequence length 312
Comment (tr|A0A024R539|A0A024R539_HUMAN) Uncharacterized protein {ECO:0000313|EMBL:EAW74067.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_1818009 OC=Catarrhini; Hominidae; Homo.
Sequence
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
GREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGMAARLETRTRNWGSREAC
LGKGGMQREGAL
Download sequence
Identical sequences A0A024R539
ENSP00000294119 9606.ENSP00000294119 ENSP00000303991 ENSP00000294119 NP_056937.2.87134 NP_056937.2.92137 XP_005274090.1.92137 gi|21361517|ref|NP_056937.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]