SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024RCK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024RCK7
Domain Number 1 Region: 44-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.15e-35
Family SCAN domain 0.0000652
Further Details:      
 
Domain Number 2 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 514-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 320-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.49e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 214-270
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000116
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024RCK7
Sequence length 578
Comment (tr|A0A024RCK7|A0A024RCK7_HUMAN) Zinc finger protein 192, isoform CRA_a {ECO:0000313|EMBL:EAX03136.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_31426 OC=Catarrhini; Hominidae; Homo.
Sequence
MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVFRLRFRQLRYQ
ETLGPREALIQLRALCHQWLRPDLNTKEQILELLVLEQFLTILPEELQTLVKEHQLENGE
EVVTLLEDLERQIDILGRPVSARVHGHRVLWEEVVHSASAPEPPNTQLQSEATQHKSPVP
QESQERAMSTSQSPTRSQKGSSGDQEMTATLLTAGFQTLEKIEDMAVSLIREEWLLDPSQ
KDLCRDNRPENFRNMFSLGGETRSENRELASKQVISTGIQPHGETAAKCNGDVIRGLEHE
EARDLLGRLERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPYQCNVCGKAFS
YRSALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQCGKAFSQSAG
LILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGH
QRSHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIH
TGEKPYQCNECGKAFIQRSSLIRHQRIHSGEKSESISV
Download sequence
Identical sequences A0A024RCK7 Q15776
gi|56699473|ref|NP_006289.2| 9606.ENSP00000332750 ENSP00000332750 NP_001265048.1.87134 NP_001265048.1.92137 NP_006289.2.87134 NP_006289.2.92137 XP_011513172.1.92137 XP_016866755.1.92137 ENSP00000332750 ENSP00000402948 ENSP00000332750 ENSP00000402948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]