SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024RW81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024RW81
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 1.13e-19
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024RW81
Sequence length 83
Comment (tr|A0A024RW81|A0A024RW81_HYPJR) LSM domain-containing protein {ECO:0000313|EMBL:ETR97147.1} KW=Complete proteome OX=1344414 OS=C-30) (Trichoderma reesei). GN=M419DRAFT_26895 OC=Trichoderma.
Sequence
MAPAQPELKKYLDKRLFVQLNGSRKVIGVLRGYDVFLNIVLDEAVEEKDGGEKIRLGMVV
IRGNSVVMLEALERIGGDDRQNR
Download sequence
Identical sequences A0A024RW81 A0A0F9WU04 A0A1T3CTT0 G0REQ9 G9MKE5
jgi|Triha1|439995|CE270146_10305 jgi|Trive1|32934|e_gw1.3.1916.1 jgi|Trire2|21972|estExt_fgenesh1_pm.C_50210 XP_006963552.1.9351 XP_013959334.1.71794 jgi|Trilo1|7131|gm1.7131_g 51453.JGI21972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]