SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024RXA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024RXA3
Domain Number 1 Region: 33-99
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 7.98e-23
Family Hydrophobin II, HfbII 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024RXA3
Sequence length 102
Comment (tr|A0A024RXA3|A0A024RXA3_HYPJR) Uncharacterized protein {ECO:0000313|EMBL:ETR97713.1} KW=Complete proteome OX=1344414 OS=C-30) (Trichoderma reesei). GN=M419DRAFT_125146 OC=Trichoderma.
Sequence
MQFLAVAALLFTTALAAPSSDVNGIIRRANAFCPEGLLYTNPLCCDLDVLGVADVDCVVP
PAKPSSCKSFGSVCASIGRKPRCCAVPVAGVALLCTDPIPAI
Download sequence
Identical sequences A0A024RXA3 G0RVE5
jgi|Trire2|123967|estExt_fgenesh5_pg.C_290049 51453.JGI123967 XP_006969202.1.9351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]