SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024SL88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024SL88
Domain Number 1 Region: 14-81
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 5.54e-20
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024SL88
Sequence length 83
Comment (tr|A0A024SL88|A0A024SL88_HYPJR) LSM domain-containing protein {ECO:0000313|EMBL:ETS05708.1} KW=Complete proteome OX=1344414 OS=C-30) (Trichoderma reesei). GN=M419DRAFT_23834 OC=Trichoderma.
Sequence
MENGGISQAEGKDPSSFLSDIIGNSVVVKLNSGVVYKGELQSVDGYMNIALEKTAEYVNG
VKRREYGDTFVRGNNVMYISADS
Download sequence
Identical sequences A0A024SL88 A0A0G0A024 A0A1T3CDS4 A0A2H2ZT63 G9NA13
XP_013950976.1.71794 jgi|Trici1|6752|gm1.6752_g jgi|Triha1|490999|fgenesh1_pm.2_#_920 jgi|Trilo1|45871|e_gw1.1.433.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]