SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024TCK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024TCK7
Domain Number 1 Region: 340-596
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-35
Family Ankyrin repeat 0.00098
Further Details:      
 
Domain Number 2 Region: 69-156,235-428
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.06e-32
Family Ankyrin repeat 0.0046
Further Details:      
 
Domain Number 3 Region: 154-253
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000051
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024TCK7
Sequence length 622
Comment (tr|A0A024TCK7|A0A024TCK7_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETV91321.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_14141 OC=Aphanomyces.
Sequence
MCQRPNAFNTTAHSDEDRQDLHDATLVGDDIEQDMVLDFLHNLDNPARTQINVNFETQSG
MTPLILACILNQHVDRVLAEPTLDINYKNAYDCSALMAACEANQLEVVQKLLAHPAIDLG
DLNASFCMACKGGHDSVVDYLLSTYPDIDLNYGMTTEDDQIEHISGLELAIMNGHEKVVL
SVLKQCFSTDYAKFNATLHVRASALSKACQVGNVNIAKLILATGNFESIHLSDGMNEACS
NGHLPIVQLLVDDYEVDINYGEPLDALDSDDPDMFPLGVTPFYLACQSNHKEIVQYLLTL
PCLDPRQLCSALNAAPDMDIVDVLLSHPKLNINDTVGDLPPLTIACVDGHLPKLARLLAV
PDIDVNYRHNNDTTAFMIACSKGSVDAVKLFLGHPELDLSAVNQHGADVLSIASDAGHAD
VVSLLLEHAHFDAKEVRGEALGVACAHGRIDVVKLLVACPAMNANHVELGLFLACQGGHH
TIVRFLLETSPHAVNVNALMAIPGQESATCLIVACGHGHDRVVAVLLEHPSIELNVVQGT
PYVPLVQACSFGHFEVVKLLLGHPKIDVHCKGAGTTAMAAAQAGKHVTVQAILRQHVAPK
CREPPQKRQKPTSPPASHPTKP
Download sequence
Identical sequences A0A024TCK7
XP_008880158.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]