SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024TQR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024TQR5
Domain Number 1 Region: 29-215
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.8e-50
Family PAPS reductase-like 0.0000475
Further Details:      
 
Domain Number 2 Region: 272-342
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000616
Family Thioltransferase 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024TQR5
Sequence length 366
Comment (tr|A0A024TQR5|A0A024TQR5_9STRA) Phosphoadenosine phosphosulfate reductase {ECO:0000313|EMBL:ETV96344.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_10505 OC=Aphanomyces.
Sequence
MQRYTADEWTWRGLDVPPPTTFSPAYVAHVNAILRSKSAAEVVMWAADTFGPSLALSSSF
GIQSAVMLHLVSQLTARVPVVWIDTGYLPPETYAFAATLQQALDLNLHIYQPKMSPAHME
AVHGKLYESSSAEDHQLYGRLRKVEPMERGLTELGATALLVGLRADQTSHRRGLDIVHVH
NGRLKICPILHWTQQDVDAYMARHNLPYHPLKALGYATVGDAHSSRPVTDRDTDIRATRF
RGHAQECGLHLSDDNKVGKEDVPPPRYDDVDAIVYSKPACKFCSLAKDVLARNKWSYKEV
IVGKDISYPSLCHIVGKPVTTVPQIFVQGQYIGGYTELDRFVHTAVDRELLPPFQTSGHI
HASTSA
Download sequence
Identical sequences A0A024TQR5
XP_008875136.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]