SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024U1W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024U1W0
Domain Number 1 Region: 783-894
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000249
Family Ankyrin repeat 0.0085
Further Details:      
 
Domain Number 2 Region: 2149-2245
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000368
Family Regulator of G-protein signaling, RGS 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024U1W0
Sequence length 2257
Comment (tr|A0A024U1W0|A0A024U1W0_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETW00244.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_07635 OC=Aphanomyces.
Sequence
MADDVKVVAAAPSHESDSDGDSAVDKTRRTDAGQPPPNVVQTVIFQLPPPIDTAARRRRK
LKRTRLQVQRIMGWYPSDAIHEMMQLDQSAIDAAARERAARKVNDVVELQRALQPRKRKP
DNVDGGTSQLSPRHIPSTPPASLPTPSSCITPPYGNVSPAVEDDVALQALAAETAALEES
LARLEQRDITSSTSTIEYTLHSATPSDFNFAPMSTHRQQLSGLLTSSSTSSHDVRSHCRD
RQISTQRVLSNNLRDLYLQVAAVPVNDDGYADRRERDTFLEGHRHQVRARASTIRIQTVW
RMHRFRAIYLRWIATKRRKQRRVFRAWVLLHAIDQTVRARLCRRAFTEWAEEVECNIKLR
SIELKLLQHSSTLYKLPTIVKNLFVTNSRGDEWLNGPQSLERRARAVSTRTVLFVDQAFA
AVEDRSGDRSCNRIYELRIEMEHARQAVARKFVQTTFLKWKAMHEAHSRVAVNAEMCLRR
AFRLAFLKRPAWVGERVLVAFQMWHRYSVFKWHKRRCLDVPIFSSPLAQWDQWLKAYRDE
QIRILEAQAKGPLAWMRRYFHFLARFWHQRRAKKRANVKAKLHYQRHMLAELFATWHGDT
VANLETRSRLKQVFHAWRFYALQKQHCRPQKRRVGIKTKQRQSARAWEAWKEVVARHEMT
ELDRLSKLLQPQVYPRMCQVLFYWAHVASQRAKHHVFQRWKASLLQRKNFAKLWCTSTQL
YAQALVRTTFAALRTTVSRSAATSPPSTLQLAPDPDATLDALERAFPYMHSCETRMDVEP
YSLYSFHTAVRDGHVAAMEAMMQHDPSLVCGREPVFGNTALHVAIHRSDKHLGWFHQREV
LSSLLAHGASAFAVNHRGQSALMATADLHMRHYLQSNGYGFNATNSPAQIRLHGANTTPI
WHAIAVMLVQVDTDERKLGHAWLGTWHSFMPRPPPTDEKKADRAPFLYVMANKLLHRQRV
QAVQERVRAMVSSNRRNTHAMLLHDRRVYPDECYLEWVAGSDGISALDVPLNTPSDVPPF
HATHYFGKDTSHVLETHLATDFVQHLVAKPALELKAVEDEVKALDTMVRATENQLLQLER
HGAKKLKEVAIDEPTTKTFASIDEEIMHVQHHRAWTELRIAVKLAHPQHPPPVSSDEAAI
IAALENDLPTETEVLVKLDDMIVHEKKRVEAVQAVVDASRTELEAHQDQYTQLLALYSGE
TADNMYSQLVTTRLAVDEHKVACEAAEKKLRKHQAKLEQLDTVLKLYSGPIDEQRTYTQE
EYATLSGLLHLHQHSFDELAVARSTLESRFKALDQESLEQPAQANAERATRKSFRTVAKR
LLVQHQVLTQMRRSSSALLELKQHKWFIHRPSSQDTLGRVDETRQSADHPAALTKVASTG
VVRAGLQQSLDHDNVVVAPSLVQAYRRSIMLLFDAERQMVANAVEAQRRAELESQESFVE
VNPVTGQVDPPPSLHASIHDGPASHAATADDVARLDRARRRGTLAMDTVDMPDKANDKGD
MRVNRTRETLRRILRTKGNDGKDKVDLDSATPVLDDNDMPSLSLDDIDARSKRQIYGSRF
EFANFTVAADSDDSSIAALLPGSSRIPQSARGGPMALWKADGAVASIPASALSFVNKNVH
ETHVTQPAAVGPQRTSPPKTAARTDVPPLQRASSTRSPVRHRHSTVEGIPDRDEHRQRRR
LSCATPVLSLSNDAPEDARPDLPHLQLDAAKNVTMAIPHPSSRTRRNLTPRSELVQVIEV
AEPKSEPQDSHELRQGSPRDPSKTDTPPDPVAVDMEVAEMSILPPAQPEESPPPPNSDLD
AALDDVDALLDNFTTFSQTLLLRQYVGTSTVTSAVQESLASSSTMPRPRVGHLPLNATAV
PLRSMDDILQRDESLRQRRLKTKQKYPKRTTSTNALPSIADPASLSLVGKSSTLRAPQSM
SRLTKAPRFIPGYSAHSTNRDVMPLDDNQSLSASEDDWGGRIPLVELQLFHDPPKVPKAV
APCLANGQPLKHHVTMLEERPFHKAFDATQVFDHLPQQTAMGLVGTRLHRDQHAQSMPAL
LPPQVQAAGVQGGRLTTEQRGMVWHAFANKPMDDAVKQAYAAIYPHTYHTTDTCPAPTST
KTHDQSNANASTSTTSVVAGVALDRSVAPVVHPVPSPQRFARGRDVKSKDVCFWQAVEGF
KSIQDMPTKGAAFQLPPAKLRRLRRAAEIYDEFLRHDSPQVLAWLLRDHPATVQAIETQV
AAGDVAVNRVLFDAAQRLVECRMKQQRRKEHQHGTTE
Download sequence
Identical sequences A0A024U1W0
XP_008871269.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]