SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024UX00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024UX00
Domain Number 1 Region: 4-99,139-394
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-69
Family Duffy binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 386-595
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.92e-35
Family Duffy binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024UX00
Sequence length 1214
Comment (tr|A0A024UX00|A0A024UX00_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW15131.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_05955 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
FHEACKQKYDGKYYGWKCVSSGEATGKSDGSICVPPRRRRLYVGKLDQWATNTQASVSPQ
VGGKAAQGNGVSKDPKVELLKAFVESAAIETFFLWHKYKAENSKTQGGVGSPQLPQPLQL
PNGDTLSGEQTPEKMLQNGTIPPDFLRQMFYTFGDYRDICLGKDIGNDVDEIEKKIKDVF
TNGDAKDDQKRKNFWDKYGKDIWDGMVCGLSHVVSGGDKDRLKKNLTTNSDYKDVNFPSN
SGHRSGFLSKKKKKIDKIINECRGVNGNRYSSGDGEDCEKIVRQEYDTVADLEYPTCAKF
CRSYKEWINIKKDEFDKQKNKYEKEIVDGKITSDSTYYYKFNNNLKTKYSSFTNFVETLK
DGTCSNYNTEDSKIDFKNPDDTFSRTKYCKSCPVFGIKYVGGKWSEYTKDEFSRTNHKFS
KTIKNKKGPNNIGILISDNRANGFGDELKQFCNNTTIFKGIRKDQWACEYSSDLDVCNLS
NNNNNTHVDKSISIRILFKRWLEYFLKDYIKLKKKLNSCTNNGEESICINKCKKKCVCAG
KWAEEKMKEWDIVRKRFFNQYNVDNLQKIYQVKSFLGQTIYSTDVQNALNEGEDLESLQK
SDVCYNSGRSDKKQCDEKDVIEILLNRLTEKIEPCKTKDNQEIDPNSCDPYTQTEELYDE
KPLDDDTSTTSVVPEICKDFVPPEPAPPSLPEQEEKDKAKEDRGKEEVPFTPSLPPEDLP
PEKNVPVPPPKKPETTPKQRKKQKRQLPTHTSILPEMLSISSFPLTVGVAFAALSYFLLK
KKSKSTIDLLRVINIPKGEYGIPTSKSKNRYIPYASDRYKGKTYIYMEGDESDDYTYIGD
ISSSDITSSESEYEDIDINNIYPYKSPKYKTLIDVVLEPSKRDTFNTQSDIPSDTSTNKF
TDNEWNQLKQDFISNILQSTQMDLPNENIIDDFMDKGIQPNNLILDVNMPEKPFITSIHD
RDLDNGEEVTYNINFDVSKNINEITNTTNDSKYVSNNIYSGIDLINDSLNSDQHVDIYDE
LLKRKENEIFGTNHTKHTTTNSIAKQTHTDPILSQLDLFHKWLDRHRNMCEQWNKNKKEE
LLDKLKEEWNKKNNNNSDLTHTSSNIPSGENSIKNVLNTDVSIQIDMDDPKPINEFTNMD
NIIDNLEKNSGPYYDIDEDDIIYFDIDDERTPMDQNNMDNNKSNVPTKVQIEMNVINKQE
LFQEEFPISDIWNI
Download sequence
Identical sequences A0A024UX00

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]