SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024UXJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024UXJ7
Domain Number 1 Region: 170-508,535-554
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-76
Family Duffy binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 651-769,803-908,968-1012,1048-1158
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-67
Family Duffy binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 1155-1373
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.94e-42
Family Duffy binding domain 0.0043
Further Details:      
 
Domain Number 4 Region: 11-145
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.49e-21
Family Duffy binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024UXJ7
Sequence length 1934
Comment (tr|A0A024UXJ7|A0A024UXJ7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW14974.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_06113 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKKKKEIKKDTNYKTPPEEFAKRPTFLRWFTEWGEEFCKERQKKEDKIKSECNGKSAADF
CNKEEHPCKKACKEYESYVKKKYEEFKGQTNRFVQKARDKNPDKEYSGYEYKPNIQSKQG
NDYLKDKCDNNKCSCMKGNARSDKPEDEPFGKYFNKTLAMCDCTSGVYKPSVLPVLPQQT
ETCENLKKYIQENEKERNKYQGCHKKFYKGWDCTKDIHRTHKGACMPPRRQKLCIYKLTR
DNDTKDLKELKMSFIKSAALETYLAWEIYKGNNIDAITELQNGQIPEGFKRIMFYTFGDF
RDMCLGTDISSKANKSTGVGKVESSINKLFPNVKNSKSQDRKTWWNSIEKEVWEGMLCGL
SHAGGNDAIKSNQDYQYSEVKIFKQSDGSGITLSQFAERPQFLRWMIEWSEHFCKEQKEE
YGKLVAGCTGCDVSTDGNCTQKGNCKNCSSQCKEYQKFITQWKVQWEKQRNKYTELYEKT
NNDSNHLTDAIERSVIDYFKTLSSNGTTYSTAGKYINEKGYIQDCKEQKNFSNDDGDNKY
AFSNYPNDYEKQCTCKTEESTPPPVQPPQPKPAGGPGGVGRSLPPAGPDDVLSSSEDDED
EDDDEDDEDDEEEASEEEGGASEAETEEDEEHVDGAETPKDTTDQDLPSPPEPTTEKSVD
ACGIVKMVFEDGSTLKEACKTKYDGKYYGWRCVNTTGSAEGEAASSNPRVRRSAPGGEKS
GDKGAICIPPRRRKLYLHKIEGVDTTESVIEWFVKSAAVETFFLWHKYKEEKKPPATQNG
ALPLPLAPDVSQEDDPQKKLEKGDIPEEFKRQMFYTLGDYRDICIGGDRDIVGDTIVSNT
DSTEKSSGKATKISDVIKEFLSKQNSGDNPSPRSVKTGSNSGNDPASLWNKHAESIWNGM
ICALTYKDGGEGKSPQVDDKVKKALLDGEGKKPKNNGQQDYTYEKVELKDNDENGGPRTT
GASIKTEPTKLTDFVKRPPYFRYLEEWGQHFCKERKKRLAQIKVECKVDENSGSSRRGKN
GNKKCSGYGENCDDNLSQKYNILPSFNCRSCGIECRKYKNWIKGKRKEFDKQKEAYGEQK
KKCQTQRKGAEGDDHDKEFCATLNTYSKAGDFLERLKNGPCSKTYNENDNGKDNQEDEIN
FNDPEQTFKHTKYCDPCSQFKIDCKNGKCDNDKGGDCNGKNSIDANDIETMGNFTHDVDM
LVSDNSGNGSQNDLKDCIKAGIFKGIRKDVWTCGNVCGYNVCKPINVNDLKVNGTQNQNQ
IIIITAFVKLWVQNFLEDYKKIKHKISHCTNTVEGSKCINGCQNKCTCVKAWITKKSAEW
TNIKNRFNEQYKNNDQTYPVRSILEELIPQIGAANDKAEHETLEEFEKSVGCNCHGRSKK
ENDKNNDVIDCMLNKLQRKITACQKLPIGSPEEKCGEDPTPLEDDDEPMEEENSVTQPKI
CPKVEEKKKEEDESECKASQSPAEPEQAAEEPARPATESEQKPEEELPPPPAPAPAAPPS
TPLAPADEPFNRDILEKTIPFGIALALGSIAFLFLKKKPKSPVDLLRVLDVHKGDYGMPT
PKSSNRYIPYVSDTYKGKTYIYMEGDSDEDKYAFMSDTTDITSSESEYEEMDINDIYVPG
SPKYKTLIEVVLEPSKGNGNTLGDDMVPTTNTFTDEEWNELKHDFISQYIQSRLPMDVPQ
YDVLKELPMNIGGNVFGDKMDEKPFITSIHDRDLYTGKEISYNIHMSTNSMDDPKHVSNN
VYSGIDLINDSLNSGNQPIDIYDEVLKRKENELFGTNYKKNTSNNSVAKHTNTDPLHNQI
NLLHKWLDRHRNICENWGKKEDILNKLKEEWEQDNNSGDIRSDNHVMNTNVSIEIDIDEN
KGKKEFSNMDTILDDMEDDIYYDVNDENPSVNDIPMDHNKVDVPKKVHVEMKILNNTFNG
SLEPEFPISDVWNI
Download sequence
Identical sequences A0A024UXJ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]