SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024UXY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024UXY2
Domain Number 1 Region: 826-949,985-1078,1137-1306
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-81
Family Duffy binding domain 0.00052
Further Details:      
 
Domain Number 2 Region: 279-478,528-670
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.15e-77
Family Duffy binding domain 0.00022
Further Details:      
 
Domain Number 3 Region: 5-196,252-271
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.89e-43
Family Duffy binding domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1290-1518
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.05e-39
Family Duffy binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024UXY2
Sequence length 1603
Comment (tr|A0A024UXY2|A0A024UXY2_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW15608.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_05479 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MWDKDDGAQKMDVILKNVFGTLHKSLEGIRNHPKYAYDKNKTSPYKQLREDWWEANRHQV
WRAMKCATKAIPDMKCNGIPIEDYIPQRLRWMTEWAEWFCKMQSQEYEKLEKECGGCKEM
GGQCTNDTEDCQRCTQACEEYKKKIEPWEKQWTKIKDKYKTLYEQATKNGETSGTPNEKD
KDVVDFLKQLLAQNSAAARNRVIRAAGNSATRVIATTAPNTPYATAAGYIHQELQNMECQ
VQKEFCEKKRGDKKKYAFRHQPYDYDDALRCDSRTAPEPKKVEKKEVLDVCGVVKGVLSK
PRNKKGGIDGCNPKKDYPSWHCNKKESMAENSGACIPPRRRKLCVSSLTKQYRIKAIEDI
RTEFINCAAIETYFAWERYKKDNKKAEDELKSGTIPHEFKRQMYYTFGDYRDIFFGTDIS
THAHISDVSPNVITILEKENGTKSEGKQKSKNELLDDWWDEHGHEIWEGMLCALTYKDKT
SGSGGEGKTTITQDESLKEALWDEASNKPKNHDYNSVTISSVGPSGEKTYLSKFAERPQF
LRWFIEWSDEFCRERKKKEEEVKSKCTSDYEGCKKTNGKTSCANACEAYKTYIKKKEIQY
TTQKKKFDTEKNKEKKEKEYENYTGKESHEYLKDKCFLHTCSCMEKVKTIGDYWKNPHET
YDDNKLETKCECHQTPPKPPTAGGVAKSGEPPAPSPPPSDDHVDENEDEGEDDDFEEDEV
ADGTEEEDEDHGPDDIDEFVEQDEEDDSESEASDDDDDDEDDDDDEDDEDDDSENVHDGD
NGSEDEEEEEEEEEGDNSEEKAEESKAEEDLGEAAEAPQPPAAPQEPTLPPTQNDVNVCS
IVGGILTDKDNLKEACKLKYDGKYYGWKCISDTTTTSGATTGGSICVPPRRRRLYVGRLS
QWASRRDDTQVSVQTTSLSPSHPRDDAALREAFIQSAAIETFFAWHEFKMDKKKEDEEKN
TADGKLVTHISSVEKELQDKLEQSGTIPEEFLRQMFYTLGDYRDICVGVKDDVAQALKKS
GDTKMKEISDKIQKILNGATSGVPPVTENSVTTPQQTWWELHGPDILKGMVCALTHKTEK
PGDVDKQVETALMKKLEKDNGEYTYDKVTFKGGFDDDSKTSQAMALGAGPKAHLETTTKL
KDFVKRPPFVRWLEEWAEEFCRKRKIKIDKIEKECRGKYGNRYCDGDGFDCSEIGPNTDG
SFSTFKCPSCAKSCRSYKEWISKKKEEFNKQKEKYRSKIDDAKSNSIEIYDETFVETLAE
NYTSIHSFLKKLKDRSCSNNNNEDDTIDFNEQGETFEHAKYCNPCPVFGVNCNRGDCSGA
PVKQCKGKNVMGKEDIKDMKDHIEKIDILVSHNAAKTFPDDLSVCTDRGIFTGITENKWS
CGYLCDLDVCVLENYQQGIDDKQNVPIRVLFKRWIENFLKDYNKINDNISHCMKNREGSP
CINGCEKKCECIEKWIEKKKGEWKKVRNRYLEPYKNEESQKYYSVKSFLQEEQFKDDVYK
AIKPYKDLDTLQYSTECTYSNPSEKGQTKYNDVVVCLLDKLEKKIGECKKEHDEKKPNCV
ELPPSTLKSSETPDDPEPTKDDTSTTSSRPNFCPQVEPPPKPE
Download sequence
Identical sequences A0A024UXY2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]