SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024UY81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024UY81
Domain Number 1 Region: 56-346,369-486
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-86
Family Duffy binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 821-923,963-1069,1119-1303
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-78
Family Duffy binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 2051-2408
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-62
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 4 Region: 2455-2723
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-51
Family Duffy binding domain 0.000095
Further Details:      
 
Domain Number 5 Region: 1652-1965
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.2e-50
Family Duffy binding domain 0.00027
Further Details:      
 
Domain Number 6 Region: 1295-1521
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.22e-30
Family Duffy binding domain 0.0025
Further Details:      
 
Domain Number 7 Region: 479-688
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-27
Family Duffy binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024UY81
Sequence length 2774
Comment (tr|A0A024UY81|A0A024UY81_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW14980.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_06108 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVIQITGGEGRIEDATAKHLLDSIGKKVYDKVHSEVDAYRDKLKGTLSKATYPKDKYPEG
TTPKDPCELEYKYHTNVTSTEIDPCEHKKGKRLSEVHSSECDNRKIRDSDKKNNSVGACA
PYRRLHVCDKNIQQIKTENITTHNLLLDVCLAAKFEGQSITGYHPQYEVQYPSSGSTMCT
MLARSFADIGDIVRGKDLYIGNKGEKKKLEEKLKQYFKKIYNDLTKDNIKRQEAQKRYQD
DKYENYYQLREDWWNANRQEIWKALTCDAPNGDVHYFRKTCSMGQSHVNDKCTCANGDVP
TYFDYVPQYLRWFEEWAEDFCRKRKKKLENAIKNCRYDESGEPKYCDLNGYNCEETARGR
NKFAPDSNCNKCSVACKPFVEWLDNQQKEFEKQKKKYNEEIKKKDQTTRTSITIGDKTIN
NLYVKEFYEQLRENYGKVEEFLKKLNNEAICQKNPQVKQEKASNVDFTKSDPHDIFSHTK
YCQACPLCGVTGEKGKWEAIKEDCAKKKERIFNEQNTTDIPILTPEKGKSNILDKYKNFC
KNSDGNNSDQIEKWQCYYDDKGTEDNERDDTNDCVQGIWKTFTGEQDVTSYNVFFYNSII
EMLNDSIEWREKLNSCINNKTGNCRKVCKEYCECYRRWIEKKKTELEKIKDHFRKQKDIK
DPAEREMTLTGILNVTFLEDIKDAYPYEQQLEKIEKRLKDKMQEDFIFERTQTSIDKFLQ
EEEQFAKECLEKHKCPDPQKPPGGGPGVARSETNEENATQSPASPTEDSEEEEDEDEVEV
EGSATEDPPAVPSATPVPAGPPVNVCDIVEKILTKDALQDACQQKYDGKYYGWKCIPSGT
TSGDKGAICIPPRRRRLYMGKLEEWATTSVTPQAGGGEAQASDSSQSSSHPTSPTSQSPN
GDLLAAFVESAAVETFFLWHRYKKEWHHKNKKPQEGSQLLQTTLDRDSGDGGDQTPEQQL
QSGTIPTDFLRLMFYTLADYKDILYSGGVDNTSDSDNNIVLEASGDKQDEMKKIQKAIDE
YIKSLKQAASVPKPQPPGQQPSEKKREEWWNNNAKHIWEGMICALTHKTDNPQEVDEKVK
KAFFGENNNKNPGTTSGTTNGTYKTQYDYNSVKLDNSDTQAKSNDNPTLEEFSKRPTFFR
YIQEWGEEFCRKRTHKLKKLEKECRGEYDNGGKKYCSGDGHDCTDPDNQHNKMFADLFCR
DCHIQCRKYRKWIDLKFEEFHKQKDKYDGEFQKIKVNNNGDKNCCEQIKNYSSAAEFLKE
LKHCKNGEGDKEKGNEDKKNNKINFEEPLQTFSRSTYCKTCPLNGVNCNGPSRRSGGNDQ
CTEVNGKVKSWQSVFNANGGNSTTIDVHMIDRRGTFIEEYMQEDSKNSQNSNDLFNASRL
FKGIRKQQWECRFNKAENKDVCKLDKFEKNIDLNDYTTFKVFLEYWLQDFIEGYYILKKR
KIMDHCTKSGGNTCSEESKKNCACAKVWVDQKKKEWEEIKNHFNRRPHDNGNDIKSKVRN
FLETLIPRMDLVNDKGKIDDLSIFLKSYGCNGTENSKESKKDENNDLVLCLLTKLGKEAE
QCKDKPPNCDNLPSPSDKTLDPLVEEEINPIDDDTDTTDKQSPDICKDVEDTKEPETDSD
IFCDRNKQPKCDDLKIDMNTTYKPKTNLIGLGAHYHWAGSDYPNVYISPRVDQLCLQPLI
NLTGSLKKSDSVTGDKFSEALQECAYNEAKLLYEYYKGEGKENIYTKNGIIKEEDIKQHT
LEAMKRSYADYGNIVKDDVLWNYKDNYMVNELIFDIANKNNQIQNKSLIDYETKQRKTLW
ESIRNDIWKAMLCGYKKAGGCMKNLPNGGEFCTLPSTDKDNQFLRWFVEWGENFCIRREQ
ELKQLKDKCKNGICKITDEGEIQECKSLCGKYWQFLSNSKTQYEKQSILYNQLKESTSEF
QNTDPFTFLKDKCSSKFSCFGYKADNNVSKIFEYPSDEVKNLCTCTSTDTSKTTPTNCIE
KAAYELQKEATNKIGSASNSLKIKDNVIDLSDCRKGNYVVVDNGVDGKKIDKDMLKKMFP
SNRYSCEPNEINSFHIGKAWDCNYRNINDRDKNLCLPPRRQFMCMKKIEHISAKDVKDKE
NLLRIVMEIAKEEGIRILRNYQEQNKTQFSEICDDMKYSFADLGDIIRGRDLWKEYPNYH
TTEQNLQRIFKNIHNEITKGGDKDKYKYDRQYFHELRNDWWNTNREAIWKAMTCCAPRHA
YIYKKTNTGDKIRSTDMYYYCGYTKEPPYDDYIPQRLRWMKEWGEYVCKILNEKINDIKN
ECDKCKLNDPNCLNKDDGNKCKSCKEKCREYNKLIHNLKSQLDIQKEIYKELYKKIKDNG
IRFTTDSDKEVIEFLKEVEKTGCDVKSFDKYLDKTSHCINYKFNEKEKEKETYAFNLNPK
VYKEKCKCGITKDPLDKCPDQNTCTKYHAIQCFGKEHDDNAYWLSTYIKDNKAIIKNVLV
PPRRRHLCLRIYRAKFYHLRKEINNFKEFIFSSAFSEAKRLKKVYKDDNDKLLQAMKYSF
ADIGNIVKGDDMMQSPTSDNIAKIFRGMKYKGIDRTKWWNENKYHVWESMLCGYRKAVGN
TQTNLNCRFPDIESVPQFLRWFQEWTEIFCKRKKELEEEAQNQCNNITCDKDTGRTNSIC
AQACKNYSNFILIKKNEYQSLNSQYDMNYKETKAEKKESPEYFKDKCNGECSCLSEYFKD
ETRWKNPYESIADKALKGKCNCKKVEPPPIQPPQADEPLDPTILQTTIPFGVALALGSIA
FLFLKVKVNIYIYV
Download sequence
Identical sequences A0A024UY81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]