SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024V1Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024V1Z4
Domain Number 1 Region: 21-206
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 4.71e-98
Family Gametocyte protein Pfg27 0.00000000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024V1Z4
Sequence length 217
Comment (tr|A0A024V1Z4|A0A024V1Z4_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW17028.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_03857 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSKVQKDSAKPLDKFGNIYDYHYEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKDP
EKFNYALKDRVSIRRYVRKNQNRYNYFLIEERVQDNIVNRISDRLISYCTDKEVTEDYIK
KIDDYLWVEQRVIEEVSINVDHAREVKEKKRIMNDKKLIRMLFDTYEYVKDVKFTDDQYK
DAAARISQFLIDVVDSYIIKPIPALPVTPDEPHHNNI
Download sequence
Identical sequences A0A024V1Z4 A0A024VNV3 A0A024VXX7 A0A024WMU9 A0A024X3V2 Q27336 Q8IEU2 W4IZR1 W7FKF8 W7JPQ5 W7JTX5
PF13_0011 gi|124512786|ref|XP_001349749.1| gi|23615166|emb|CAD52156.1| XP_001349749.1.26446 5833.PF13_0011-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]