SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024V6M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024V6M7
Domain Number 1 Region: 3-245
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-41
Family Duffy binding domain 0.0000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024V6M7
Sequence length 758
Comment (tr|A0A024V6M7|A0A024V6M7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW17870.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_03230 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSNINNKDSSTEWNCKEDVGCVPPRRQNLNMERLDNENEDSVPDFMKKTFYLAAAGEGKK
LREKHDESCDEFCDAWNRSLADYKDIFQGKDMWNDGKYGEAKNHIKNAFGDMNNRKAMLN
EIEKGIKDETFSRENGLDVCKSQCEERSRDDTEDQFLRFFAEWEEEFCDGLNKHEEQLKS
CTKDINCDIKCSNFKDWLETKKDEYDIQSRVFEKKYANDNKSKHLNYLKEGMNKCKVKNP
EMVFKSGFANVAECRNLNVEGAGNKNSNNLKDLDSNSDKDGIVSESYKATKKNGESIMDR
IPKSFNKLFGYFSGSQEEEQKENDVSHRNNYDNILVDKFHRSSLLDKLDDRMFFDELNRD
NIMEEVLSKIPEPIIREAPKYVPKKPVPPQHIPRGDNVPRNIDVNGSKDEYSPETESANS
KIKPTYEENDEDKSKISIETSEIDRDKEPFRISEEKKVVKEDVQELENIEYEFDETFDFF
DEDAKRNIDDIRKDIQSQIMKSVENYNSEKEEFKRNIETQLIESGDGMNAGNYSSALQDN
STEIPTMVLVPGVLTVFLLTIIWVLVYKHSLIDRVHGTGKTKKEEKMKELESEEFPKEKY
NIEDMEETEKENEIEKIMDENKETEQTEEGNTEEFVQEKELNQETLENEIIVDHIKEEED
TRNVKEQESVLEESPIEELPVENNIGKINEEVEEFILNEIPLEEQVPKELPQEEIEEIVV
EELPIDEHLFSEETTVTEEDTFKGQLINEEKPVEEKSV
Download sequence
Identical sequences A0A024V6M7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]