SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024V7Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024V7Q2
Domain Number 1 Region: 45-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000662
Family PDI-like 0.062
Further Details:      
 
Domain Number 2 Region: 399-509
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000142
Family PDI-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024V7Q2
Sequence length 515
Comment (tr|A0A024V7Q2|A0A024V7Q2_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW18592.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_02491 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKHFCFNNILYIFIIYIIFLLHLNNIILCEGAIWEGISKDEIRNVKHLTHEVELQIYSQH
TQNCMALFCNEKESKCKNVYKEFVKASNELIDNDVVFVYVDTISLAKTADNFEIKNIPKI
LTFKDFDPEKGYTFNRKYTKENILEWFKLLPEPSIEIMEKNNVEKYVEMHKKKGYASIIA
FCIRGSDNANKFVHFGETQKLPNLAVGLIYVENDEDVKIEIFNGPGSTIPKENFKYKDTY
VPYNGIWTSDSIYQFAENYMKQFPVIINYHRKSLPPLNGDIYFYIFNRFGEYSDTLYVEL
YDLIMKHNQIKFVFPRKDEVLEHFNIENNMSLISIMDYNNASFVTLSQMLRPKKYAKIMD
ENITVSHVESFLDEFLKNNLAVYRKSEKPIKRREKQKYQILCSNDFESYVMDPEKLVLIF
YHVQGCKECKPLFTFWDTVANYFHLENKYKDVLVATMDAKLNDMIDESVDYYPSLALYPK
GENKLKRKHILLFPMKLDTLIDVVDEYLEDLDQDL
Download sequence
Identical sequences A0A024V7Q2 A0A024W8A4 A0A024WSS7 A0A0L1I4N5 A0A0L7KGB0 Q8I2V9 W4IIA1 W7F8G8 W7FJE5 W7JLX4
PFI0950w gi|124506936|ref|XP_001352065.1| gi|23505094|emb|CAD51876.1| PFHG_03675T0 XP_001352065.1.26446 5833.PFI0950w-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]