SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VA07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VA07
Domain Number 1 Region: 329-679
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.06e-69
Family Duffy binding domain 0.0000507
Further Details:      
 
Domain Number 2 Region: 806-1161
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.11e-65
Family Duffy binding domain 0.0000773
Further Details:      
 
Domain Number 3 Region: 1170-1460
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-51
Family Duffy binding domain 0.00019
Further Details:      
 
Domain Number 4 Region: 1-263
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-42
Family Duffy binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024VA07
Sequence length 1935
Comment (tr|A0A024VA07|A0A024VA07_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW19853.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_01239 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKYSFYDLRDIILGIDNLEDEKQKTEENLKKIFNKNGTSVGKGSDSTTGNPGSTARKFFW
NENKECVWNAMICGYKRGRDDGNSGNSARSDEDLKKCGSVPSDDDYPMGKNRDEGTAYQF
LRWFAEWGEDFCKHKEKELEKLVGACNDYTCGDNEDKRKKCTDACTQYKKFISEWKPQYE
KQIKKYGENKDKIYSEHPVAKDAEDAREYLDKQLKKICENKSGDCEYKCMKDVSTQRLTD
GNSQNMPASLDDEPKEVEGKCNCQVPRGPPRVRRETPSPRVSLISKATASKKEAKTAPPT
KQPKKVENLTTEMRAQTRTRRAAQQTRKRTSTATTTESDVGTMVKAILSNKPDSRGGIEG
CNPKTYGQYPKWGCIVGKSKENENGICMPPRRKKLCINNIQYLNYETENKRDNDIKEAFI
KCAAIETQFLWLKYIIENPAAENELQNGTIPDEFKRIMYYTYGDYKDMFFGTDISNDKKI
ITVTNSVTTILNENNKKKQDKKKDEELRKIFWEKNKKFIWEGMIYGLTYHLTDENEKEKI
RDNYQYNDMTKLTPSLEEFVKRPQFLRWFTEWAEEFCNKRKEQLKKLEAGCKEYECNGSD
DGKTQECAEACVTYQNFIKKWKTEYERQREKFKKDKDGKKYKDYPSTERDIEKATCAHEY
LNMKLKELCGNKDCSCMQKPSSQLPKTTQQSQSSDANDMPESLDYVPEEFNKCECPELSK
KGSMIHTKKITEPKIPMNCVEKAAYYLSKEAENNMDITLKEKFIPIESTKEKESKNSWTN
NNPCDPKKPYAPDKYIGRRNPCENREENRFKVDYEWKCYKNSKFYQEKKRVCVPPRREHM
CLRNLDEIKIERLKDSNYLLKMVRRTARNEGIDIIKNFNSENGCAMNPICDTMKYSFADL
GDIVRGTDMLRIGGYLPPVEIKLYKVFEYIYGKWRNKNKGRNKYNDVQTFRSAWWDANRK
DIWKAMTCKAPEDAKLFRKGRMDGFERITLIQDKCGHKDDPPVDDYIPQRFRWMTEWSEY
YCKALMEELEKFKKSCDHCKTSDRCKNDYDENKCEQCKTRCQEYKNFVLKWKSLFDIQSN
KYKELYEQPIYTKISTYDHVQNFVQKLKTFKSECSVESFSEYLHETSKCLNYKFNENDGS
SNIRTYAFEETPKSYKEACSCTLPSKNPLDNCPTDQNKDGCKELQTFTFCSKNDYDNNLD
NWNAYLVLNSSDDNKGVLIPPRRRHLCTRPITAYNYRKGDKEILKKKLLTSAFSQGQLLG
QKYKSEEELCFEAMKYSYADYSDIIKGTDMMDTSLSEKIKKIFETSNEATENRKTWWENN
RRQIWHAMLCGYKIATSKVTLDEGWCQLPKDEETNQFLRWLIEWAKQACKEKKHVSDSLK
TKCPRSNEDNFEASELLRQPGCQNDIRKYISLNILIKNTMENLNIKYKQLKDQSSGNIDN
KPSEENVQSYIKSKDSQCALELNDINEIVTGTKNNENNEFKEVLKKLYPGLYFVEDETHK
NHVLDGNIKEEEQTVRPKALYFFTPHVDSFYQAPLFSTHRVAQYDPKNDILKSSISVVIV
SALGLIALHFMKKKFKSSVDLLRILNIPQGEYGMPTLESKNRYIPYRSGPYKGKTYIYME
GDTSGDEDKYMWDLSSSDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKRDIPSD
DTPSNDTPRTNRFIDDEWNELKHDFVSQYLPNTEPNNNYKSADIPMNTEPNTLYFDNPEE
KPFIISIHDRDLYTGKEISYNINMSTNTNNDIPMNARNDSYRGIDLINDSLSGAKPIDIY
DEVLKRKENELFGTKHPKRWKKDNDGGNVPIDNRTLNTDVSIQIDMDHGKPKKEFTNMDT
NVDTPTMDSILYDLERHNEPFYDIYDDDVYYDVNDDNKTSAHHNNLDVSSKVQIEMDVNT
KLAKEKYPISDVWDI
Download sequence
Identical sequences A0A024VA07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]