SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VDJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VDJ0
Domain Number 1 Region: 499-800
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-52
Family Duffy binding domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 191-468
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-48
Family Duffy binding domain 0.00000399
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024VDJ0
Sequence length 1407
Comment (tr|A0A024VDJ0|A0A024VDJ0_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW20240.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_00864 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MRKTLKLFYISGFLFSSRALCKLENYIKNEYDRENSFYILNNKVEKEYEKGTNNNINIDK
LANGSLEMLENNKNFEEKILHEDICKLNKENIEKEGLYKPNTFKSIGNDLLYKKGKLNFL
YEYGMELLHINKVPMNRMNNSRGLGDSNMSFLDISNNNMNSLNSMNNLNNSNNFDSSNSL
SFVDMKSIHRCIKKRAKGERDWACNDKNTKEPNICVSDRRVQLCTGNLIELPINDSTKEK
FKEKLILAAQKEGSLLFEKFGKKYNEEFCLNLKWSYGDYGDIIKGTDMEGLGRSIKVEFE
IDRIFKRDNKKSAENRKKWWEEISTHIWNAMIKEHKEKFPKDVKECSADKPLDEPQINRW
LMEWAYDTDYNKNLWYNKLDDSKNKCNRICPKEEICKSECKKYKAWIDKKNNDFTILSEI
YLKYNKKSSLYKTAFEYLKQKWDKYKELNFSSIFDQLNAKYYNKCICQNNKIENNALYVK
IEDICNNTKVKSIYGELYCKEKGNDKIWQCINEHIKDFPDVCGPPRRQQLCLGNLDKDEF
KNVNDLKKFLNEIILGIRDEGKFLIEKYRKNMHENMYLDERACKYLNYSFDDYKNIILGK
DMWRDPNSIKTENILKGNFEGIKANIVSMYPSYADLSLDEFRKHWWDQNKKQLWEAISCE
FYKGNHTGVCLMEDDNDNQYLHWFREWKNDFCIDKLKWNDVIKEPCIDKKVKSPKPSENP
SDVATVCNKSCTDYDKWIINKRKEYKMQSSKYKRDRSLFNNVIQNLKPWEYLSMKCTECT
CNLDTQTFVYPYKGYEDICKSTVKPYDPEDIKDEEFNEPSLNVNPLSLTSQDVTERVSSV
DDVLSIKENVDLKPFKPKGGTQSSHVDQVGNPRESESKPSGANGREDPSTESSTYNDGVI
TSSSSLGSSSGRDVSSSPVGVGDEHEAKELLPPQKIIDGVTQSDESTLSQHGKESSQEQH
NLDGSSLSRHSNQDEEGSIITSDVAHGTNSLFGGQIQDQATLSGESELLTTSPPEHETSK
MDTHAGGKNMEQVRNASVDSSSEMSNGGRGGLKTKEMKGEEVTGITSKNDINLEDSTVHS
RQNKIENSGDNTQGKEHINVLQGMDKHLENPPTSERGDSVLESEFSKLNRTSHTHDNNRI
ETTAENNIGGLSNSNVHDGRDSQRNRMHINSRSRHGSLESDIVVRGDDISNIEGGEEEEE
DANTLKYPRNVLNNKNSRTYNIEEYIYRDVNKVADDIMRSYKSNRCTNNLSSNYCSKLKK
ESLSNSCTNEDSKHLCCSISDYCMKFFNFNSSGYHSCMRKEFSNHAYKCFAGKGFSNMYY
FAGGGLFFIILFLLGAKSSILNWSEDNELNGTAFEEANFEDAAFEVTTGQDSAFEDYDEN
AYRIGLLMNQKIQSAKSSDYLEYHVDN
Download sequence
Identical sequences A0A024VDJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]