SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VE81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VE81
Domain Number 1 Region: 691-793,824-931,998-1167
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-77
Family Duffy binding domain 0.00085
Further Details:      
 
Domain Number 2 Region: 300-632
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-72
Family Duffy binding domain 0.00017
Further Details:      
 
Domain Number 3 Region: 4-187,241-261
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.59e-41
Family Duffy binding domain 0.0006
Further Details:      
 
Domain Number 4 Region: 1157-1372
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.79e-36
Family Duffy binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VE81
Sequence length 1455
Comment (tr|A0A024VE81|A0A024VE81_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW26812.1} KW=Complete proteome; Reference proteome OX=1036724 OS=Plasmodium falciparum FCH/4. GN=PFFCH_05765 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MEKHFISIFKKIREQLPEKERKKYTDNDKYLELRADWWTANRRQVWKAMKCATKKDKNMK
CNGIPIEDYIPQRLRWMTEWAEWFCKYQSQEYDKLMKECGECKAKGEQCTNGKNGCEKCK
NACEKYKEEINKWKKQWNNMLVQYVILYLETHIAAANGGTHTYSGAVEPKDKPVVDFFKE
LQKTIKSSVAASDKGVKPTTSPYETAAGYIHQEIGYGGCQEQTQFCEYENGVIPTTDSGT
NNKNYAFKNTPKDHDDACACKSRPKPEKKTEKPKEEEDPECKTVEGILKDNNGNEQVGEC
KKKDFTRTYPDWQCGNINLVEDRRVCMPPRRIKLCLYYLKELKVNEETKEQDLREAFIKT
AAAETFLSWQYYKSKNSMDIKKLQSGEIPEEFLRSMYFTYGDYRDICLNTDISKKEGDVS
DAKGKIDAYFNKYTDTNRTKWWDTNGPEIWEGMLCALTHGVTNTDNKRKIKTDYSYKELN
KSKNVTTPLEKFAERPQFLRWMIEWGEEFCRERQKKENKIKDGCIEGDGCNNTQHPCNKA
CTEFQDYVKKKKKEFTGQTNKFVTDASKPKADPEYSGYEYKNGVTKQGNDYLKDKCDNKK
CDCMEGNVLGDNPKEKPFGIYSHEYKNKCDCLGGRHAPSAPHPPAVVPTEQEAEPPPQEA
PPKKTQEPQNNECTMVENLFLNDPEKKFKDACKQKYDGKYYGWKCVPTTSDKSDGSVCVP
PRRRKLYIGKIKEWADKVANTGESQTLTGGESESTSEGKTTSKSSGKDPREALRDAFIQS
AAVETFFAWHEYKEEKKPPAQEGAAALLKEVTPQEDPQNKLKSGTIPTDFLRQMFYTLGD
YRDILFGDTSIVEAALSPSEKEKMKEIQKKIDEILEKSGNENSVKTVQSSRTTGPHSVKS
HPNSGKDRKTWWNENAQHIWEGMICALTYKESENGDKTIVKDDKVYNKIFGTTPNNPIPK
DNLTPGPPVTTNGTTGTPTGTYNDRYKYQTAKLEEENSGENTPLSKFVLRPPYFRYLEEW
GQNFCKERKKRLAQIKKDCEQGGGRCSGYGENCDDNLLKKYTIVSDFNCPRCGTSCSFYK
KWINTKRDEFNKQSNAFTKQKTDAHNNNGFCEKEGKCETAGDFLEKLKTGPCKNDSGEHK
TGDDYIKFDDESKDKTFGHENYCDPCSQFKIDCKKANCTGDENKEKCNPRNGTINATDIG
NGVNSAEDIDMLVSDNIGKGFHDGLEACENAHIFEGIRKDEWKCGKVCGYNVCKPENVNG
KKGNGNQIIIIRALFKIWLEYFFKDYNKIRKKLKSCMNSSDATPCIKGCAEEWLKTKKAE
WGKIKKHYETQNEDDDIKSFVKNILEFLQSRTEFKNAIKPCKSLDKFEESCGLNSTDNSQ
NGKDNDLVLCMLNKLEKKISECTSQSSGSPEAQCDSLAPIETPPEEPLEEEEENQVKAPE
ICKDVIKETAEEKED
Download sequence
Identical sequences A0A024VE81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]