SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VEB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VEB1
Domain Number 1 Region: 9-321,353-406
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.16e-83
Family Duffy binding domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024VEB1
Sequence length 423
Comment (tr|A0A024VEB1|A0A024VEB1_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW27064.1} KW=Complete proteome; Reference proteome OX=1036724 OS=Plasmodium falciparum FCH/4. GN=PFFCH_05513 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MFVNPFSDTLGGQCTDSKIKGNKYNRNTRKDCGACAPYRRLHLCHHNLESIDTDKIDNTH
KLLLEVCMAAKYEGNSIKTYYTEHEYTNPDTKSQLCTVLERSFADIGDIVRGRDLFHGNP
QEKEKRDELESKLKKIFGKIYEGLKTTKGAQNYYKDDPKKNYYKLREDWWTVNRDQVWKA
LTCDVKGNKYFRGTCSTGTATYEKCRCNDDQVPTYFDYVPQYLRWFEEWAEDFCRLRKHK
LEDAIKKCRGDKNEKYCDLNRHDCVKTIRGDHDFVEEDDCIGCHFSCAGFVKWIDNQKLE
FLKQKNKYADEMQKYTNGETRGGGGSGKKRVAGKSNYDRYESKFYDKLKKNNYKNVEDFL
KKLNNEAICQKRPEASGETADAADFTKIKTNETFSHTTYCKACPWCGAHKGKGGNGKWIA
KDD
Download sequence
Identical sequences A0A024VEB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]