SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VEB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VEB5
Domain Number 1 Region: 44-141,217-393
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-48
Family Duffy binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 378-610
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.76e-43
Family Duffy binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VEB5
Sequence length 796
Comment (tr|A0A024VEB5|A0A024VEB5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW27069.1} KW=Complete proteome; Reference proteome OX=1036724 OS=Plasmodium falciparum FCH/4. GN=PFFCH_05508 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MWGNWNSGYKEEKKPQGGVGSPQLPQPGSGSDDSDHPQNQLASGTIPPAFLRQMFYTLGD
YRDIVVRGVADDKNGGNNIVVDTSDDKDAMQKIQKKIKDIVEKPNGGTPPGKTSDNPRVK
WWKTNGQHIWNGMICALTYTENTSGPKGQTSITQDPSLKGALLDDSGKKPKTKNNNGPDY
TYENVELKDNDENGGPRSGSSTTSQTTQSLPSGEKKPPKLSDFVLRPPYFRYLEEWGESF
CRERRKRLEKIKGECTEDGDTQKYSGDGEACDKIHNEDGTVPDLEGPSCATPCGLYKRWI
GRKKIEFTKQSGAYDGQKTKYEEERTGAEGNSGIYDQNFVGKLRKDYKSIGLFLNSLKSG
PCSKKDNDNAEDNIDFGDEGKTFKPATNCAPCSKFKVNCKNVNCHKTKGNNCNGITDITK
DNIETMGNFTQEVTMLVSDDSKSGSGFKGNGLEPCRSADIFKGFREDVWKCVNICGLDVC
GLKNGNGSIDKDQKQIIIIRALLRRWVEYFLEDYNRIKHKISHCIKNGENKCINGCNKKC
TCVEQWIQKKRTEWETIRDRFNEQYKNETPDDYNVRSFLETWIPQIPVANANNDGKKLIK
LSQFDNSCGCCASASSTNGKNEDAIDCMLDKLGEKAKTCEQKHDENGDKKCNETLPETID
ETFDNDIEIEEAKKNMMPTICNDVIKPEEETDDKCGKQDEEEKDDKKEKGDGGENRGSEG
PKPAEPPSSSTEDSGGPKTNEDTPVIKPEEDPLPPAPADEPFDSTILQTTIPFGVALALG
SIAFLFLKVKENIYIC
Download sequence
Identical sequences A0A024VEB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]