SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VF37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VF37
Domain Number 1 Region: 357-697,724-742
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.41e-78
Family Duffy binding domain 0.0000648
Further Details:      
 
Domain Number 2 Region: 1-292,332-351
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.16e-71
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 3 Region: 759-858,898-995,1047-1096,1120-1220
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-70
Family Duffy binding domain 0.00049
Further Details:      
 
Domain Number 4 Region: 1224-1437
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.67e-41
Family Duffy binding domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024VF37
Sequence length 1617
Comment (tr|A0A024VF37|A0A024VF37_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW26805.1} KW=Complete proteome; Reference proteome OX=1036724 OS=Plasmodium falciparum FCH/4. GN=PFFCH_05772 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MPPRREHFCTSNLEYLQTKGSPFCGKDSTFKVINDSFLGDVLLSAKSEAKFIIDKYKGGN
SPDGFKDEETICRALRYSFADLGDIIKGTDLWDENEGEKRTQGHLKEFFQIILNKNPDIE
EKYKKIEDKKHLHLREDWWEANRHQVWRAMQCELKNLKKSNGDCHYNSRGTPLDDYIPQR
LRWMTEWAEWYCKMQKKEYEKLKEQCKECKAKGDSCNNISSECGKCKDQCKKYKMFVDIW
KKQWINISNKYQILYLLAKIDARNVRPSVYFGYEKDKHFLKFFKEIRKENYGKKTYETAE
GYVHQEVPHMECKTQNQFCEKKHGDTSSNGEDNTKYTFKQPPPEYKDACGCEGRNKPVSE
KKGEDACTIVETLLINKGETDDIDGCNRKYKDPNYPGWDCKNNIDNGNVGACMPPRRQKL
CLYYLKELNGETENDLREAFIKTAAAETFLSWHKYKKDKQNEKPSSNPDNELKGGTIPPE
FLRSMIYTFGDYRDICMDTDISAKTDKSHVKGAIDNIGKVFSNNGAESRNGLKRDEWWNT
YAEDIWKGMLCGLSHAGGGNKETLTTTYTYANVKFSDDKNAPTLEKFAQRPQFLRWFTEW
GEDFCKEHKKELETLKGKCDKCDVQDGTCEKESECAECKTQCEEYKKWLKTWQENYKNQK
ERYNKVKGTREYYNDNDVSAEIQANEYLDKQLKNMTCTNGSTNENCDYMCMGNTSKQQKQ
ASDNTDMPASLEYPPKEINGKCDCKDKQPEPEVSLVPEAPKQGDNACTTVENLFEGEGKT
KLKEACALKYGRGKYSAWKCYTDASKPDDGAVCIPPRRQKLYLKYLQELTDGTSPEALRQ
AFIQSAAIETFFLWDRYKKIKEKEKLEEQARQNGELPFLNGDSVDGGEQNPQTQLKSGTI
PTDFLRQMFYTLGDYKDILDGKNIVVDLLSGSSGSDKEMVEREKQIKESIDNYFNSGKGQ
PSEKKSPDGLTRHQWWEKYGEDIWDEMVCALTYEESGAIGGTPKQNDTMKTTLYDTNTAK
EDGKYNYKTVVLKDENSGTQAKTNTPKTTLKDFVLRPTYFRYLEEWGETFCRGRKKRLEK
IKEECTENGFGTKQKCSGYGEDCKDNLFNNHYTTFPDFYCHSCAKHCSSYKKWIQRKKEE
FTEQANAYKEQQKNCPTQSKATGPNNVGNGFCGTVQRWSNAAAFLQKLGPCKVQNGEDNN
KIFDEKGDTFQHTKHCDPCSEFKINCEKAKCSGTNGNNCKGGKISPNDIKDSTEDINMLV
SDDNPNGVEDDLDECVLGDCHGAGIFEGIREDVWTCGNVCGYNVCKPKKVDGKTFEGQAN
GENQIIIIRALFKRWLEYFLQDYNKIRKKLKPCMNNSDGSTCINDYDKTYNCVDEWIKLK
MAEWEKIKKHYLEKNEKGDDGMTSLVRNFLEDLQDRPEFKNAIKPCPNLKAFEKSCGLNT
AESSQKSEDRKDYDLVLCLIDRLDTKIKKCKEKHQTCTDTALPQTLEDDEEPEDLPLEEN
ENQVVQPNICPSTPAPTEPEEKGACDQAPTTPKEPVPPAPKEVVPEKKVPAAPPKKPEEP
PPKVPEQTKENKKPKPQRPKPPQIVYEHPLLKPALMSSTIMWSIGIGFATFTYFYLK
Download sequence
Identical sequences A0A024VF37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]