SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VF74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VF74
Domain Number 1 Region: 50-268,302-316
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-54
Family Duffy binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 318-412,457-636
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-49
Family Duffy binding domain 0.0008
Further Details:      
 
Domain Number 3 Region: 1012-1182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-48
Family G proteins 0.000000571
Further Details:      
 
Domain Number 4 Region: 633-846
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-38
Family Duffy binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VF74
Sequence length 1200
Comment (tr|A0A024VF74|A0A024VF74_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW27369.1} KW=Complete proteome; Reference proteome OX=1036724 OS=Plasmodium falciparum FCH/4. GN=PFFCH_05141 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPDSTGTQDDDAKNMFDRIGKIVHGEAKNDAKTYEGELKGDLKKAASTSSETVDTINPC
RLVEEYRSKTNGGAAGGKRHPCRKEDVDRFSDKEGAQCHTKKIKDSDSNGGACAPYRRLH
VCDKNMEKIPTSKTSTDTLLAEVCYAAKFEGDSIKTHYPKYQRTYEGSGFTLCTMLARSF
ADIGDIIRGRDLYLGNKKKNQTERDKLDKKLKEIFKEIHENLGTQDAKEHYKDEDDKDPN
YYKLREDWWTANRHTVWKALTCEAPEHASYFHATCSMNGSGAQANHYCRCNGDKPNADKV
NIDPPTYFDYVPQFLRQGTIPEEFKRQMFYTLADYKDILFSGSKDAKNGVNYIISGDKEM
KAKEEKIKDAINNYFSNSGSTQTQPSDKLKSWWETNGEYIWNAMVCALTYKDSGDKGQTP
IQDKQVESTLIKDGNPKDPKYQYQTAKLEDESGAMPTTQPPTLDSFIKRPPYFRYLEEWG
QNFCKERKKRLEKIKDDCKVENGGGSSRRGKNIETPKCSCYGEDCKDNLPENPSTLSDLK
CPGCGRECRKYKQWIKRKKIEFTQQSNAYSEQKTDAQKNNGDNGFRGTLNTCDTAGDFLK
RLGPCSKTYNENGNGTIDFSNTDQTFGPAKNCKPCSEFRVTCNNVDCSKDKRSECTGNNK
MHITAENIKNCTEDIGMLVSDDNTNGNKFDRLNECKGTGIFTGIRKEQWECGNFCGYVVC
KRDKVEGRANGEKQIITIRGLVTHWVQNFLEDYNKIKHKISHCIKNGEQSPCIKGCKDKC
NCVDEWIKLKTKEWEEIKKPYLEQYKNEYGDYYNVKTVLEKFEHRPEFQNAIKPCPTLEE
FEKSCGFNGAHSSKTKGDDERDLVLCLIEKLEEKAKNCETQPSSSDCTPSTENPSTTLDD
EEPEDLLLEEEENTVKAPNICPEPEKPPEEKTDEKCEPPPTTPKDTAADSGEETHVLKPE
DEATEPKKPTPEKEEKVSPPPNLFDNPSVQTALMSSTLAWSVGIAFTALSYCVGKTSLMN
QYVNKKFTNQYKATIGADFLTKETIVDNEQITMQIWDTAGQERFQSLGVAFYRGADCCVL
VFDLTNYKTYESLESWKDEFLIQASPKDPENFPFVIIGNKVDETNKRKVQSLKVLQWCKS
NNNIPYFETSAKNAINVDQAFDEIARKAMKQEHQEEQIYLPETFALNNQSEQKMYKSRCC
Download sequence
Identical sequences A0A024VF74

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]