SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VFU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VFU7
Domain Number 1 Region: 249-298,345-371,429-451,495-589,637-684,718-813
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.68e-67
Family Duffy binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 5-114,154-174
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-26
Family Duffy binding domain 0.0067
Further Details:      
 
Domain Number 3 Region: 810-914
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000144
Family Duffy binding domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VFU7
Sequence length 918
Comment (tr|A0A024VFU7|A0A024VFU7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW27070.1} KW=Complete proteome; Reference proteome OX=1036724 OS=Plasmodium falciparum FCH/4. GN=PFFCH_05507 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNADEPAEIQKTYNDFFYYWVAHMLKDSIHWRTKKLEKCLKNGKTMKCKEWCNNDCECFK
KWIGKKENEWKAIKDHFNTQEGFDSEGDKGIPVGGGFGFTHDVVLQENLKLQFLNEDSTQ
DTQNSLNAEELKHLKQLSEMLQNENAQQTAGATGKKTLMDKLIDYEKEEAKTCLDTHKSD
PCPLPEEDKDIPPSADPSSPPAERIDTDADDTASDDEDEDEEEEEEEETEEEDNQKETET
VEPAPKEPAVKKEEVKVCETVKSALTIDNLTKACQQKYEKGREKFPNWKCIPTNTNDVAT
MEGSSESGNRSKRHTDSTVTAPGKSGATTGVTTTRSSGESTSDKGSICVPPRRRRLYIQK
LVEWAKNYNTETSQAEGSSEQSVQSTRNGGTEGASSGPSTSEGSAQTASQPNSRPTSATA
SSHAPNGDALLLTAFVESAAVETFFLWDRYKKEWESRHATPEVGAAGGLLPINGYNPYSG
DSDEDQSPEKQLQQGTIPEEFKRQMFYTLADYKDILFSGSKDAKNGVNYIISGDKEMKAK
EEKIKDAINNYFSNSGSTQTQPSDKLKSWWETNGEYIWNAMVCALTYKDSGDKGQTPIQD
KQVESTLIKDGNPKDPKYQYQTAKLEDESGAMPTTQPPTLDSFIKRPPYFRYLEEWGQNF
CKERKKRLEKIKDDCKVENGGGSSRRGKNIETPKCSCYGEDCKDNLPENPSTLSDLKCPG
CGRECRKYKQWIKRKKIEFTQQSNAYSEQKTDAQKNNGDNGFRGTLNTCDTAGDFLKRLG
PCSKTYNENGNGTIDFSNTDQTFGPAKNCKPCSEFRVTCNNVDCSKDKRSECTGNNKMHI
TAENIKNCTEDIGMLVSDDNTNGNKFDRLNECKGTGIFTGIRKEQWECGNFCGYVVCKRD
KVEGRANGEKQIITIRGL
Download sequence
Identical sequences A0A024VFU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]