SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VGS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VGS0
Domain Number 1 Region: 110-531
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-81
Family Duffy binding domain 0.0002
Further Details:      
 
Domain Number 2 Region: 873-1188,1242-1261
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.2e-78
Family Duffy binding domain 0.00012
Further Details:      
 
Domain Number 3 Region: 1759-1849,1886-1981,2033-2217
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-75
Family Duffy binding domain 0.00063
Further Details:      
 
Domain Number 4 Region: 1298-1648
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-73
Family Duffy binding domain 0.000062
Further Details:      
 
Domain Number 5 Region: 3226-3488
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-62
Family Duffy binding domain 0.0000782
Further Details:      
 
Domain Number 6 Region: 2885-3156
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-52
Family Duffy binding domain 0.0000597
Further Details:      
 
Domain Number 7 Region: 2553-2848
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.4e-47
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 8 Region: 2214-2431
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.94e-34
Family Duffy binding domain 0.007
Further Details:      
 
Domain Number 9 Region: 554-774
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.2e-26
Family Duffy binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024VGS0
Sequence length 3900
Comment (tr|A0A024VGS0|A0A024VGS0_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW27884.1} KW=Complete proteome; Reference proteome OX=1036724 OS=Plasmodium falciparum FCH/4. GN=PFFCH_04689 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPPEGGHRGAARGRGGVAARGRGGVKMARVRRGVKMARRRRGGRRGRGGGGGSVEDDAE
KYKNAQDAKELLDMIGKDVYDEVHKKDADYRNALHGLWSNVTYPNDKRRTGSTPPNPCEL
NYKYHTNVTKGHGRENPCKDRWEIRFSDKYGGQCTNSKIHGNDDSNGKDVGACAPFRRLH
LCDQHLAHMEDDKINTKDNLLLEVCLAAKYEGKSLVEKHKEFKKTHNDSNICTILARSFA
DIGDIIRGKDLFRGDNREKKKLEKNLQNIFKQIYNNLMEDLKKYPTKSAEAQKRYKDDAP
DFYQLREDWWDANRLEVWKAITCGAPKEAQYFRKTCSNDQTWTNHNCHCAGGTVPTYFDY
VPQYLRWFDEWADDFCRKRNNTLKLAKKACRNESKQLYCSHNGFDCTKRIEKGSSCSRAD
KCTECSTKCIPYEYWLEKQQNEFNMQKDKYDKEIEKYVRKKDNSVSNINYKYYKEFYEEL
KKSYKSVHDFLTLLNKGSYCKEGVKGESTINFNKTDDKGAFDRSEYCQPCPNCVVQCKDG
NCTEDTKDNNCRNKIIEQILRSEQTTEIDVLINGNGPGVITEKFEDFCSNTSKDDGKYYK
KWKCYNKNNDYNNCEMNISSYNDPDESKLMVSVECFDSWARNLLIDTIKWEHQLKDCINN
TNVTDCKSKCNSNCKCYEKWIKRKEHEWKQVKEVLNKKDKNAHNYYNKLKYVFDSFLFPV
MNALNNEEKGKWDQFTKDLEKKFGPSVESAGTANSQDAIKLLLDHLKDNATICKDNNTNE
ACDSSKKVKTNPCGRNNNGGKLVRVKRPAEMMQRSARKQLEKGAGETKLKGDATRGKYTS
SGSEKKLDKICDISLQHSNRNPGKSEGPCHGKNTGRFDIGKNWTNVKENEKTSYSDVYLP
QRREHMCTSNLEYLETGNTPFTGSDTKRINDSFLGDVLLSAKYEAENIKKLYEKNKDQSG
HEVICRAVRYSFADLGDIIRGRDMWDKDEGSKKMDVILKNVFGTLHKSLEGIRNHPKYAY
DKNNKPPYKQLREDWWEANRHQVWRAMKCAIEKDNITKCNGIPIEDYIPQRLRWMVEWAE
WYCKAQNKYYGELETQCDNCKNKNDGKDCTQSTPECALCKAACKKYGENIKKWEKQWEKI
KEKYEKLYKKALDSVNGNGKGEKSTTSGPKDENDVVDFLKQLLPQNSAAARVRVKRPAGS
RATRVTATTAPITLYSSAAGYIHQELGKAVGCNTQKEFCDSKNGKYAFKDPPTLYKEACK
CENNTKQAQKKKEEKTDACIIATNLVKDNNGKTSIHGCGSKTNVIYPEWKCHNDSELVRE
DGVCMPPRRQKLCLFYLTKSNNLNSEDDIRKHFITCAAIETYFAWERYKEDNTEAEDELQ
KGIIPEGFKRQMFYTFGDYRDIFFGTDISSCLFIEGTSNNIKHILNKEKKKHEEWWNEHG
KEIWEGMLCALTNGLTDAKEKKDKIKNTYSYDELKNPSNGTPSLEEFAERPQFLRWFTEW
GEHFCKEQKKQFDILKGLCNICTVTDNGTSKKTCDDKKKCDECKRQCQEYQKWLKTWKEN
YKEQKKKFLKDKKNGTYKMGPGGTEVNIADDPRVYLDKQLKNMTCTNGLTNENCEYTCMD
TPSSTNTGNMPESLDEKPKEVKGRCTCQKAPQPPAGTPPLAGGAEEDDDDDDEDLDEEEE
DEDDEDDDDVLSSSDEDEEEEEEEGDEDGEEDNTVDGEETQEDATENQGGKTPKVEDNVN
PCQIVQKLFENPDDFKDVACNQKYGAPNRYWGWKCISDTTTGKSDGSICIPPRRRRLYVT
PLTTWASGNTAASVSQGDGVSTETSQTSLLHAFVKSAAVETFFLWHKYKAENTRDNKSPL
GGAAVPPQSPGSESDDNNPQNTLLRGKIPPDFLRLMFYTLGDYRDILFSGSNDTKNGYSD
IVSGDNVIKERESKIQEQLKSFFSNSGSTHSPSSVTTPQALWSKYAEPIWNGMICALTHK
TETPGEVDDTVKEALLDANNKPKNNGQQDYTYENVKLDDTSDTQAKTDSSLSGVDSTLNT
PKLSDFVKLPPFFRWLHEWGSDFCGKRARMLEQLEKVCRGEYPNGDTKYCSGDGNICDET
RAQSQNTFISLHCSDCLKECMKYKKWIDIKFEEYHNQKSKYEGEFQKIKGNSNGNNNCCK
EIQNLPSAAQFLKALKHCKDDQSDRKEDNDDKKNNKIDFSEPLKTFSPTTYCKACPIYGV
ICNSSSGRRRSATNGCTKNTEPTNNEMHEVGDSTPIDILINDGATKDIDEELRNCSKKYS
LFKGLSKQEWKCQKINGVDQCKLTKPVAKTDDDKNIWFNEFFQRWLRNFVHDYNKLKHII
HPCIKKGNGKEDKCIKDCNNKCECVGNWLKKKEKEWGNIKKHYNINSNDDKETIAYRIKS
YFEQLYFDSDYKKAQEVVENESDRYKLWGCTGRDDCTTEEKEKNDDFITNLIDKLQEKIG
KCKTQHSDNPSPPCVDTPPLVEEEINPIDDDTDTTDIQKPLFCPTEEEKEETLCDDKQEP
KCDNFKNRFSNSTCEPKKNLIGLNAHNRRARTNSNMYISPRVKQLCLQPLHVLEDNNTKQ
NELIEALKECAYNEGKGLYEYYNNNKSAIGKNDSVLLDKDVETYTLEAMKRSYADYSNIV
KDDVLWNYQNYISINNMIFSIASKSNKSQHISPNDDDDVKRQKLWESIRTNVWKSMLCGY
KDAGGAFVNEDIKCKLPDTENTYQFFRWFEEWGQNFCIRHEQELKRLKEKCDNVTCNGTD
ETKKKECKMLCESYKQFLSNSKTQYENQKKEYEIIKSSYPKYEKKDAFTFLKDKCNSKCL
CFKDKSGTYFDDLLKNLPDDVKDQCDCKTSKAHDDKVNDLDKCPNNINNNKNICNKYKKR
RMCGEFKYNNSLDNWYGRNMLIPPRRRHLCLRNIIIKKNYRKGDISKFKDDLLSAAASEA
KFLFKNYEDKNEALQAIKYTFADIGDIIKGKDMMDDTAYKKINIKLQNALETTGNVSTTP
EKWWEQNRKDVWEAMLCAYKQDGREIKPNDCNIPTEENTHQFLRWLTEWGTQYCKEKEQL
KLNMQMPCKIHFDKYGIIEKRNDVHPNCLPSVEKYEVWSNNRLHQWKRLSSKFDEVKGTM
NENVKKLTAYEYLKQNCSKCICSFKDIEQTNKKSKDEGYHIYEDILDKAQIPSFLEDTAY
RYKGLNPECPEDIECSQYGNIPCSAVSHDDDNDWNSSLVRYNKTTNWGVLLPPRRRQLCL
RIDVNKFLHLRNDINNLKTFICKSAFAEAKRLKKVYKDDNDKLLQAMKYSFADIGSIVKG
EDMKEGTASDNITKIFNGSKYSGTDRKTWWDLNKYHVWESMLCGYKEAQGDTKTSENCRF
PDIETVPQFLRWFQEWTEIFCIKRKTLYDKMVTECQNAECVISKGSVDKPECTKACEEYK
NYVLKKKKEYYIQKDKYDNQFKKVLNNKDAPIFLNVHCLSEYFSDSKNWENPYDTFDDDK
HKDKCDCKKIEHPPPVVPDTRPPPPPPKSDDIFPPPADEPFDPTILQTTIPFGVALALGS
IAFLFLKKKTQAPVELFSVINIPKSDYDIPTLKSSNRYIPYASDRHKGKTYIYMEGDSDE
DKYAFMSDTTDVTSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKRDIQSDDIPSSDI
PMNKFTDDEWNQLKKDFISNMLQNQPNDVTNDYKSGDIPLNTQPNTLYFDKPDEKPFITS
IHDRNLYSGEEYSYNVNMVNSMNDIPINSHNNVYSGIDLINDSLNSNNVDIYDEILKRKE
NELFGTNHVKHTNTHNVAKPARDDPIHNQLELFHKWLDRHRDMCEKWENHHERLAKLKEE
WDKDNNNSGNINPSGNTPPTSDIPSGKLSDTPSDNNIHSDIHPSDIPSGKQSDIPKKTEH
Download sequence
Identical sequences A0A024VGS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]