SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VHZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VHZ4
Domain Number 1 Region: 413-541,593-690,744-912
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.01e-75
Family Duffy binding domain 0.00099
Further Details:      
 
Domain Number 2 Region: 898-1125
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-34
Family Duffy binding domain 0.0054
Further Details:      
 
Domain Number 3 Region: 37-278
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.02e-34
Family Duffy binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024VHZ4
Sequence length 1277
Comment (tr|A0A024VHZ4|A0A024VHZ4_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW27883.1} KW=Complete proteome; Reference proteome OX=1036724 OS=Plasmodium falciparum FCH/4. GN=PFFCH_04697 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MENMNIIKHYIILLVELFGSASDSGTNDKNEGTFYRSDYCQPCPHCGVKKNNNGGSGNKW
EAKNDEKCQPIKLYKPKPGVVGTPIKILKSGEGEKDIAEKLKAFCLTQSGSVASGDKNGG
SGSQELYEEWKCYEIDELTKDGQKGVEDDEYNNDVQTGGGLCILKNENKKEQSEANSQNE
PKEFQKSFHNFFYYWVVHMLKDSIHWRTKRLKSCISNGKKTCLKKCNNDCECFQKWIDKK
EKEWDPIKQQFSKQKITGNHVGFIEFNHDGVLEGVLELEFSNENTEEDKKNNVSAEEAEE
IKHLQKILKQDEQNTQQTAGVVTEQKNIMDKLIDYEEGIATKCKKCQEPQDTPGDPGVAG
RSETGSPDTKDTDESDHEVDDEEDEDDDEEDDGAEDNNEDGDEDGHTQETEEPQEEAVPT
KDVDPCQIVKTLFNDTSNFSDACTLKYGGNNSRLGWKCIPSGDKTDTGERAGRSRRDTSG
VPTTGKSDGSICVPPRRRKLYIHDIQSLGVEDGKAPSQEDLLKWFVKSAAVETFFLWDRY
KKLNTKNKGETQGGGLQLSGSLEQNDSFVGSTDGLSLDGSDDSNPQSKLQQTGEIPNDFL
RQMFYTLGDYRDICIGGDRDIVGDTIYKDTSDKDKEGGVTKKISEKIKQILSKLNGTHVP
EKPVQTPQVWWDTNAQHIWDGMICSLTYNTDTKSGEKLTQNEELKGQLLEKGNPITKYEY
GKVELEEDNTSSAKATKAAAKEEPTTLKNFVKRPTFFRYLEEWGGDFCGTRKRLLKDVRD
NCTQDGGSTKKCSGDGLKCNEIVIDKEKIFEDFLCSTCARHCRSYRKWIKGKRKEYDKQE
KIYNQQKKKVLENSGATYDQKFVGKLGKDYASIKLFLQNLGPCKNDNEEDNKKIFEDTNV
TFKHTKHCDPCSKFKIKCENGDCNGFEKNKCNGNTFKAADDIEKMGTPTEDVVIRVSDDS
ATGFGDLQDACENAHIFEGIRKDKWKCVNFCGLDICTLEKKNNNGQETGKKYIIMKELLQ
RWLEYFFEDYNKIKHKISHCINNGNRFICTSDCEKKCKCAEKWIEEKGKEWKTINDNYLK
KYKSGDDGGNTLINFLETFIPQTHVKKATGCSKNLEDFDKSRHCNGAANLENTNGQKRDV
VECLLEKLRKEAEKCQNQNKNQASVETQDQHSDDTKTSCNVPPDVEDDEEQPLEEEGDQN
PVGKQQPGFCPTVEEHTETVDEDTCKAVDPNTVPDDNRDKKNEEDKVEESAKESTAAEEP
SGPAGPQGPSSTTEEKP
Download sequence
Identical sequences A0A024VHZ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]