SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VU96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VU96
Domain Number 1 Region: 375-676
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.4e-52
Family Duffy binding domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 67-344
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-48
Family Duffy binding domain 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VU96
Sequence length 1203
Comment (tr|A0A024VU96|A0A024VU96_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW32037.1} KW=Complete proteome; Reference proteome OX=1036724 OS=Plasmodium falciparum FCH/4. GN=PFFCH_00534 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MELLHINKVPMNRMNNSRGLGDSNMSFLDISNNNMNSLNSMNNLNNSNNFDSSNSLSFVD
MKSIHRCIKKRAKGERDWACNDKNTKEPNICVSDRRVQLCTGNLIELPINDSTKEKFKEK
LILAAQKEGSLLFEKFGKKYNEEFCLNLKWSYGDYGDIIKGTDMEGLGRSIKVEFEIDRI
FKRDNEKSAENRKKWWEEISTHIWNAMIKEHKEKFPKDVKECSADKPLDEPQINRWLMEW
AYDTDYNKNLWYNKLDDSKNKCNRICPKEEICKSECKKYKAWIDKKNNDFTILSEIYLKY
NKKSSLYKTAFEYLKQKWDKYKELNFSSIFDQLNAKYYNKCICQNNKIENNALYVKIEDI
CNNTKVKSIYGELYCKEKGNDKIWQCINEHIKDFPDVCGPPRRQQLCLGNLDKDEFKNVN
DLKKFLNEIILGIRDEGKFLIEKYRKNMHENMYLDERACKYLNYSFDDYKNIILGKDMWR
DPNSIKTENILKGNFEGIKANIVSMYPSYADLSLDEFRKHWWDQNKKQLWEAISCEFYKG
NHTGVCLMEDDNDNQYLHWFREWKNDFCIDKLKWNDVIKEPCIDKKVKSPKPSENPSDVA
TVCNKSCTDYDKWIINKRKEYKMQSSKYKRDRSLFNNVIQNLKPWEYLSMKCTECTCNLD
TQTFVYPYKGYEDICKSTVKPYDPEDIKDEEFNEPSLNVNPLSLTSQDVTERVSSVDDVL
SIKENVDLKPFKPKGGTQSSHVDQVGNPRESESKPSGANGREDPSTESSTYNDGVITSSS
SLGSSSGRDVSSSPVGVGDEHEAKELLPPQKIIDGVTQSDESTLSQHGKESSQEQHNLDG
SSLSRHSNQDEEGSIITSDVAHGTNSLFGGQIQDQETILGESEPLTTSPPEHETSKMDTH
AGGKNMEQVRNASVDSSSEMSNGGRGGLKTKEMKGEEVTGITSKNDINLEDSTVHSRQNK
IENSGDNTQGKEHINVLQGMDKHLENPPTSERGDSVLESEFSKLNRTSHTHDNNRIETTA
ENNIGGLSNSNVHDGRDSQRNRMHINSRSRHGSLESDIVVRGDDISNIEGGEEEEEDANT
LKYPRNVLNNKNSRTYNIEEYIYRDVNKVADDIMRSYKSNRCTNNLSSNYCSKLKKESLS
NSCTNEDSKHLCCSISDYCMKFFNFNSSGYHSCMRKEFSNHVVNKYLYTYIFFINSYSSC
KCG
Download sequence
Identical sequences A0A024VU96

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]