SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VV39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VV39
Domain Number 1 Region: 2278-2618
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.23e-78
Family Duffy binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 1142-1458,1485-1504
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.88e-76
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 3 Region: 22-358
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-74
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 4 Region: 1530-1602,1636-1712,1747-1923
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-71
Family Duffy binding domain 0.00028
Further Details:      
 
Domain Number 5 Region: 729-1029,1083-1102
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-71
Family Duffy binding domain 0.00018
Further Details:      
 
Domain Number 6 Region: 1939-2133
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.85e-38
Family Duffy binding domain 0.0033
Further Details:      
 
Domain Number 7 Region: 349-560
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.62e-30
Family Duffy binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VV39
Sequence length 2626
Comment (tr|A0A024VV39|A0A024VV39_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW32599.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_06679 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MHTWYISWHTWFGGVLVRTWGYRRRHVCDQNLEFLNNDYTETTHDLLGNVLVTAKYEGES
IVKNHPNTKTSDVCTALARSFADIGDIVRGRDMFKSNEDVEKGLKIVFQKIYDLKKKEIN
DYDGDPNYYKLREAWWTANRDQVWKAITCKAPTGAHYFLKSSPDFKLFSNDYCGHKQGNV
PTNLDYVPQYLRWFEEWAEEFCRKKKDKLNKVKEACRGKTGGMYCSHNGCDCEKTIGKIR
HFVWDDKCNKCSIECGRYENWMKDQKLEFEKQKEKYESEINRYNLSIKSNKNFNDKYYKE
FYDKLKVEQYESVNKFLELLKKGNKCKNIGHDEKTYFNKSDDKVTFSRSKYCQVCPDCGV
ECTNGRCKKKAETDENCGKPPIYTIPTDVTPTDINVLYSGDGHVDIVKRLSEFCRDSKKE
NGQNNEIWQCYYMGDSRNQCKIEKSVSQKKHQTKIAPFDYFFDLWVTNLLRDNIDWKNEL
KNCINNTNKTNCNKTCNDNCKCFQSWLNKKEDEWNKITGLLKNKNGILQNYYNKLKSHFD
NYFFLVINNVNKGEEKWKKLKEDLKKEIDFSKLKTNTGDSQDSIKLLLDHEKKNAGTCLQ
NNPIDSCPKVEPQKSDEKVQPQDTPPNPCVNGQNQKVGKIKSVRDVAEGMQKQASVRHDG
DINKLKGNISLAKFNNGANPRELKTESDITNKHTNGSRHLRLRRRFLPLRIWRRRGDYNG
PCEGKDNENKRFSIGENWKTGEKVSSKDHVFLPPRREHFCTSNLENLKMNSVTSSTNVNA
SFLVDVLLAANKQVEHTMNDYKPASDQEGICRAIRYSFADLGDIIKGTDLWVNDGGEIKT
QGNLVKIFEKIKVQLKGKLNMKYDTDNEGNKYINLRKDWWEANRRDVWKAMKCKTTSSPY
RGNPPCSDDKTTPYDDYIPQRLRWMTEWAEWYCKEQSRLYGELVEKCAGCKGKQKCTQGN
GECAKCKTSCENYKKFINTWQPQWKQMEQKYSQLYEEAKKYSDSGKKDTKNKNDYVLKFL
NELQKENGVVSSTPSTKSGNTATSDVYATAAGYVHQELPNMDCQKQTQFCKNKNGVKPPN
GAEDVNYTFKDTPNGYDVACKCDENKQKPPETPKEDACKIVKELLKDKKATDDIDGCKQR
DDRTNSYPQWKCGIESGLVMENGICMPPRRQKLCLHYLTILNDSAKEEDLRKAFIKCAAA
ETFLSWQYYKSKHGNGASKLDEELKKGKIPEEFLRSMFYTFGDYRDFLFGTDISKGHGKE
SALAKKIDSIFPPNVDGKTPNDKTREQWWNENGPKIWEAMLCALSYDTETKDMDKDVFNT
LTDSNSKYQYKSVTFTSTSNTTLSTFAEIPQFLRWMTEWGEEFCKKRKEQVETLKGQCTN
CEVSSDGKICEKNSEGCTKCREECTKYQTWLKDWKDNYNKQKDKFKIDKENDQDAKQSDH
AYQYLGTILQKICKSDSTNGDCEYKCMEATSTQTKENKLPDGNTNNMPASLDDEPQEVQG
KCNCTPPPDACTIVDGILGDKSSMGYHEGCREKYKKGVFTAWDCRPGIFKDGSDGACMPP
RRKRLFLKKLHDLKGDETQVDLRQAVIECAAIETFFSWHEFKKEKEKEIKEKKERDGIYI
SSSNDDNGPQKELYGGKIPDEFKRQMFYTLGDYRDIFFGKDMSKDMGELNDKINKVFANG
GKNPSVKRQQDFWNKYAQDIWKGMLCALSYDSTSKIMNTDVHTKLTSDPNNNYETVTFSG
GFNSDKTSKTATITTKLVDFSRRPPYFRWLEEWAHEFCRKQTYKLAQIKVDCRGNEQKNE
EKYCDGDGFDCKEIVPDKNRIFADFNCPSCAKSCRSYKKWINTKNTEFNKQTEKYKTEIN
KTQRNNDDNGFSTTLKEKYNTIAEYLLSLKGPCSKTNTEDTSINFKDTNETFKHATNCAP
CPVFGVEYKNGNWINIAEKECHGKKITAENIRKNNESIKQVLMHVSDNGENGFSKELEKA
CQNSSIFEGIRKDEWICGNICKSNVCVLKNLKESTYDEKNILFRALFKRWLENFLEDYNK
INAKISHCTNNSEGITCINGCEKKCNCVDIWIEKKSKEWENIRDRYLEPYEMNSSNKSYS
VRTFLETLDPQNEVRKAIKPFTNLINFEDSNKCMDSITSKKKDCENNDVITILINKLKNE
ISDCQSKHKVIPGKECPQQSPSTTDTPQNDNENDTLLDTPSGFPPPFCNVPPNPCGDKDA
TNVVGVEVVAEILHQEAKDKMLERSGKKDEGKAKDSKVESVLKGNIKEARFKNGTSGTGL
NSECDITDQHTNDSRRRRVHRDYKGPCTGKNQERFKIGTDWKDGDFVSTTHKEVFMPPRR
EHICTSNLEKIHVSSVTSSSNINDTFLVDVLLAAKEEADFIKRKYGDKIKANGFNDKETI
CRAIKYSFADIGDIIKGTDLWDANSEEIKTQGNLVTIFKEIKEKLKSTLGDKYANDNDGK
HTQLRADWWEANRDQVWKAMKCPLPSADIIKCGPTPYDDYVPQRLRWMTEWAEWYCKEQS
RAYTTLVNGCKQCREMGGKCMKDDGKCETCTKACNTYKAKIKKWEDQWEKISQKYKTLYQ
QANDSVNGATTSSSTDEKDKDVVDFLKKLYQQNKENNKWMWSKNSW
Download sequence
Identical sequences A0A024VV39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]