SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VV94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VV94
Domain Number 1 Region: 19-231
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-37
Family Duffy binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024VV94
Sequence length 429
Comment (tr|A0A024VV94|A0A024VV94_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW32659.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_06621 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MQLRILKINLEGETFEPAKNCKPCPVFGVEYKDNKWRNIIEKKCNENTFRNTDDIKKEGK
FTEKLDMLVSDNIENKSEKDLEACKTSGIFKGIRKEQWECGNFCGYVVCKSEKGNGQNDG
TYIIQIRALLKRWLETFFEDYNKINDKISHCMKKGEGSKCKYNCQNKCNCVVQWISEKRK
EWQQIRKRYLEQYKNSDSDHYNVKFFLQQKPFYNEVNKAIKPCNGLDKFQDSSYCTVNGS
SENGVTNKKDIVDCLIDKLENLKNKTESCLSSTSGETCNDTLPQTLEDETLDDDIETEEV
KAPNICPETKEPPEEQTHEKCEEAASPDSTVPEVQEEENADKKSGSEASDTLPGPAGPKP
KPEPEEELPSAPELPEEKAPVKPAPKKPPPPARRTPELLDDPLKTALVTSTLAWSVGIGF
AAFTYFYLK
Download sequence
Identical sequences A0A024VV94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]