SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VVL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VVL5
Domain Number 1 Region: 10-113,157-253
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.56e-31
Family Phosducin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024VVL5
Sequence length 335
Comment (tr|A0A024VVL5|A0A024VVL5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW31906.1} KW=Complete proteome; Reference proteome OX=1036724 OS=Plasmodium falciparum FCH/4. GN=PFFCH_00690 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSTTNPTRETTEWDDLQRKFGNLPPLPKEIKEEEIYLENLEKLEEENILDKKNLNELNDI
EEKCIDDEYLKIIEKYKNDRINEINRMKAEDIYGEVFEISKENFLTDINEASKKNPLNNN
NNDDDDNNNDDNNNNYNSDNYNSDNYNNKQSKRKPKGTHVLLHLYSENVISCKVLNNILK
ELAQKHKYIKFTKGIYNRIIENYPENKLPTILIYYNGTCIHQICNVLDHIKGGLNNLNMP
TFEKFINKYHIFRTCHNNMYNSKDNNSDNYDDEDELNKKNIRTQKQYTSFNMFYNKNKGN
QHYDNSDNSSVEDKEIHSRGYASSYLDSKLRLNKF
Download sequence
Identical sequences A0A024VAX2 A0A024VVL5 A0A024WWI0 A0A024XE77 A0A0L1I597 A0A0L7K541 A0A0L7M646 Q8I3U4 W4IN90 W4IVU0 W7F620 W7FZZ4 W7JGP1 W7K8W7
gi|124506247|ref|XP_001351721.1| gi|23504650|emb|CAD51528.1| PFE0820c PFHG_00226T0 XP_001351721.1.26446 5833.PFE0820c-1 PFDG_01646T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]