SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VW56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VW56
Domain Number 1 Region: 2-183
Classification Level Classification E-value
Superfamily vWA-like 1.44e-27
Family Integrin A (or I) domain 0.0034
Further Details:      
 
Domain Number 2 Region: 443-646
Classification Level Classification E-value
Superfamily vWA-like 6.04e-24
Family Integrin A (or I) domain 0.0035
Further Details:      
 
Domain Number 3 Region: 223-388
Classification Level Classification E-value
Superfamily vWA-like 4.15e-17
Family Integrin A (or I) domain 0.011
Further Details:      
 
Domain Number 4 Region: 739-790
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 5 Region: 799-848
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 946-1004
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000103
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024VW56
Sequence length 1176
Comment (tr|A0A024VW56|A0A024VW56_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW32702.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_06578 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
ESASIGYSNWEKEVVPFTIGLASNLEISEKKVNMGILLFSDKIREFIKYGQKESYDKNNL
VRRIHDLKKYYKSGGFSYIVEALKYGLYSYAKSTSSRLNVPKVNILLTDGNNTDTSDFIL
TEVSSLYKKENVKLLLIGIGGPTIHKLRLLGGCDKSDGDCPYVVKAEWNNLKYTSNLIID
KICHTDKPVENPGDNSSVCNSKDDCICANYFDLTYIEVPTLNSTYTWRSDFMDCSKNIMN
SLVIDKNKVHVSLIISLEKKSVHQGFDDVNSYNKNELIKTLGKLENSTVLNKTNILDSLV
YGIQQSFGKGNRENAPKVTMLLTNSNSDISDEKALQDIYLNYKEKSIKLLIIGIGITNTG
KLFNAGGCNMNGDNCPHVYASKSFSYIGGVDTFLEVNKCDSSIDSNGGDNGNGTEGNVNP
DTPSCNDNDDDDKCNNDDSNIICTKVLDIAVVLDQSSNISKDQWNVYIKQFVINTVNQNY
LSKYRSHITIVKMGKSTKEKWSLNKKISYQKKKIIKEINKLPISYSKKKDIAKSLKYVRT
KVFKKSETNRKKLIIMLVEGKSNSNMNDLRKEVGLLKVNNIDFFAYAIDNIDETEYKILG
DCEGSVDMGLMGNSPPSPSYLPCKNIVKVSWDTLLSSTDIHMKYICNGYPEDAECSEWEE
WSPCPETCPTINNNNNNSSGSNNSSRTNIRTYFPQLSKRERKGPYTLKGEEYMGEKYGSS
CMELKSIEYRSCPINAGCNDMCGDFGEWSECSATCGEGIRVRNRDNSLDNDDKCKLFNST
EMEACNIQECDDNNNVDICEDIGEWSDWSSCSKTCGYSTRSRTFTILPEYIGEYPNCKIF
ERSETEVCAFIPACSDENCFEWEEWNEWSSPCSPRKRVQKARVLKKDDVIISSGDNNNNN
NNNNAKRGMGHKNSTFTSYNNKKSDICEEEVRHYLDKVEYDEESTCENKNPCGDWSDWSE
CDRTCNVGVRIRHFISHMFDMVGDEDEKECLEYYNKVETQDCLHLPPCDGGECSDWETWV
ECKEEDMIGNNCHKRNKKILTRKLELLKNKDITRTKNTSDVCNDYTLFREEDCPQSNDTC
INALCNEWEEWGDCSSTCGEGSFKIRKRKEPLELIPASQDINGNIGLTCAQQNIKVEERE
ACIVPACEDESTNGGTEVEGSTPSSPSDSNNNDGSS
Download sequence
Identical sequences A0A024VW56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]