SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VWW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VWW4
Domain Number 1 Region: 462-746
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-62
Family Duffy binding domain 0.00000249
Further Details:      
 
Domain Number 2 Region: 145-427
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.15e-47
Family Duffy binding domain 0.00000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VWW4
Sequence length 817
Comment (tr|A0A024VWW4|A0A024VWW4_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW32912.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_06370 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSWYKFLIIVGYTQKKLEDLFHVNGEYIKKEEDEKEKVDQNKDMLKSGLMIIDQNKDGEE
LENLIDPIKNIKDSNNLENYYDDNYNNIKFDVGNKSNHLKYMKTRNSDSDERFSNYYFID
NNLFLRDNKEQDENNKFIDTYSLYECGKKIKEMKWICTDNQFKSNNLCAPIRRIQLCIVN
IILFSENENEYIYKNDSINNKFKENILKAVKLESNLLVQKHNNEYNSKLCDDIRWSFLDY
GDIIIGRDLIYKNNTDYIKEQFKKIFNNEYNNNELNDELNNELNDEKNIKLRKEWWEKYK
EDIWEEMTKEHNDKFIEKCKYFAKDEPQIVRWIEEWSKQFLDEKNYMLFTLRNTYNEMNI
IHENNCKQYNKWVQNRKKEWTFLSNEFNKIFPERNVQIHISNIFKEYKENNVDIIFGTLN
YEYNNFCKEKPELVSAAKYNLKAPNAKSPRIYKSKEHEESSVFGCKTKISKVKKKWNCYS
NNKVTKPEGVCGPPRRQQLCLGYIFLIRDGNEEGLKDHINKAANYEAMHLKEKYENAGGD
KICNAILGSYADIGDIVRGLDVWRDINTNKLSEKFQKIFMGGGNSRKKQNDNNERNKWWE
KQRNLIWSSMVKHIPKGKTCKRHNNFEKIPQFLRWLKEWGDEFCEEMGTEVKQLEKICEN
KNCSEKKCKNACSSYEKWIKERKNEYNLQSKKFDSDKKLNKKNNLYNKFEDSKAYLRSES
KQCSNIEFNDETFTFPNKYKEACMVCENPSSSKALKPIKTNVFPIEESKKSELSSLTDKS
KNTPNSSGGGNYGDRQISKRDDVHHDGPKEVKSGEKE
Download sequence
Identical sequences A0A024VWW4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]