SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VX53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VX53
Domain Number 1 Region: 4-157,200-243,273-309,344-358
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-80
Family Duffy binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024VX53
Sequence length 359
Comment (tr|A0A024VX53|A0A024VX53_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW32820.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_06460 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MRSDGIGACAPYRRLHLCRHNLETINNTTSTTHKLLAEVCYAAKYEGQSLITYHDKHQLT
NKDSQLCTELARSFADIGDIVRGKDLYRGNNKRDKLEKQLQKYFNNIYENLVREKSQAKD
YYQDENGGNFFKLREDWWTANRHTVWKAMTCSDDDNKLAGAHYFRATCDINNEKGPSVAK
DHCRCGDGDKPKSAKDGDVNIVPTYFDYVPQYLRWFEEWAEDFCRKKNKKIKDVKRNCRG
QHKYGNERYCSRNGFDCERTIYKKGYFVIDKGCINCLYACNPYVEWIDKKKEEFEKQKKK
YDEEMQKYENGASSSSGGRAKRAAPSNINYEGYEKKFYDKLKGEYSDVNKFLEKLSNED
Download sequence
Identical sequences A0A024VX53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]