SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VXE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VXE6
Domain Number 1 Region: 367-691,742-760
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.32e-79
Family Duffy binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1052-1284
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-42
Family Duffy binding domain 0.0036
Further Details:      
 
Domain Number 3 Region: 777-820,847-872,907-1068
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.32e-36
Family Duffy binding domain 0.0037
Further Details:      
 
Domain Number 4 Region: 88-283
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.4e-31
Family Duffy binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024VXE6
Sequence length 1411
Comment (tr|A0A024VXE6|A0A024VXE6_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW33359.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_05923 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLSKSKKKQSTKYNVYEGYDKEFYKILKSENVGGLDKFLELLNEERECQEFSNDLGKIDF
KTVDGGGVGAIGGGASDSNNSNKTFSHSQYCEECPGCGVELIGNEWKEKNKGECKGGKRY
NIPKGTKHNVIPVLSFGDEHKEIIEKIEQFCAESNSDSSKLTEQWKCYYGDKEYEVCTLE
NRNKSEEDPEEIQKTFHNFFYFWIRHLLNDSIEWRDKINNCIEKAKEGKCKNECKTDCGC
FQRWIGKKKEEWGEIKKHFKTQDGFSIFGNNYDFVLENKNTIDLLFEYDSEEAEKCKKIQ
EECQPKKPTKVRNPCYGNNTYDALAGKVAQKLQQEAKKQLDRNDSRSALKANASQGKYSN
QGDPDDFKKNLCGITQKHSNAIGDSKNPCNNKGKERFNVGEKWKNGGEVKMSHTDLYLPP
RRQHFCTSNLEHLNTKSTGLTSDKAIHSLLGDVLLAAKKEGEDIKTKLTENDNRSSICRT
MKYSFADIGDIIRGTDLWDINGVQNNLKDIFSKITEELKKQHPDKFKDNDKYVGDDAKHT
KLRSDWWEANRDQVWKAMTCPTKNGNIQCGATPHDDYIPQRLRWMVEWAEWFCKEQSRLY
EELLRDCGSCTTGKCNNDKCAKCDKQCQEYKTKIQPWADQWNEISNKYQILYWQAKIAAI
NGGTEKSTTTKDDKDKNVIDFLQKLHEANYGTRGPPPEAHPDRRPRRAATSKSDVYETTA
GYIHQEARTRECLVQNVFCNNNGNNEYAFSLTPHEYKHACKCNENKASSPEELGHVVKPP
CDIVKELFSNVDTLQKACSTKYGPGKNYGWRCIPTKTSNDVTGEDGQGSRRVVRSTPESG
SNSDKNGATCIPPRRRRLYVGKLEQWANKHNTETSVSQGEATEARGSEAPAPGGKESSSG
GKETPSDKLRTAFIESAAVETFFLWDRYKKEWLAQKKAELQNGGLDLYSSGDGDPDNPQN
KLLNGRSCGNSCRFYKKWIKRKRKEYDKQANAYSKQKTKYEEGSKGAGLNDHNKEFCVKL
GTCTDAAAFLNRLKNGPCKKDNENGGNDINFGNTEETFRPAENCKPCSSFKINCRNGNCR
SGDGDTKEKCNGGTITTGNFNTMGTCTEDVVMHVSDKNANEFEGDGLDEACENAGIFTGI
RKDEWKCRKVCGLHICKQEKGNGAINDQQIILVRALLKRWVEYFLEDYKKIKKKLKPCIE
NGNGSTCINGCNKKCNCVGEWIKLKKDEWTKIKNHYLEKNKEGDKNVTSLVTNVLETLVT
QIAAANDKREQTSLDKLKTSLGCNCPENSRKNDGNENDAIDCMLNKLETKIHECKTQHEN
SVENSDQPHPNCGGNPPPDEEDLLLEEENPVEQPGFCPTPQQEPEPDDKCGKLEEKKDEK
KEQPEQPAEEDGGAIVPSGPPGSEPEADKGP
Download sequence
Identical sequences A0A024VXE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]