SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VXK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VXK0
Domain Number 1 Region: 658-1013
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.85e-74
Family Duffy binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1056-1382,1412-1430
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-73
Family Duffy binding domain 0.0000676
Further Details:      
 
Domain Number 3 Region: 1-339
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.8e-67
Family Duffy binding domain 0.00023
Further Details:      
 
Domain Number 4 Region: 1510-1818,1852-1865
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.1e-65
Family Duffy binding domain 0.0000507
Further Details:      
 
Domain Number 5 Region: 1897-2201
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.28e-49
Family Duffy binding domain 0.0000972
Further Details:      
 
Domain Number 6 Region: 2231-2427
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-34
Family Duffy binding domain 0.00071
Further Details:      
 
Domain Number 7 Region: 368-576
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-32
Family Duffy binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VXK0
Sequence length 2427
Comment (tr|A0A024VXK0|A0A024VXK0_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW32960.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_06322 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MCDRNLEEIYPEKIATAHNLLVDVLLAAKHEGKSLVDNYEEYKKEHNNFDLNLCTELARS
FADIGDIIRGKDLFLGHKQRKKHLEKRLEQMFKNIKGNNNSTLKGLSIEQVREYWWALNR
DQVWKAITCDAGVKDTYSKSPEHGTTGVSHGQCGHEDQDVQTYLDYVPQYLRWFQEWSED
FCRIRYDKLKKVKEACRGDKNEKYCSRNGLDCTRTIRRNKIFHYVPECNKCLFTCNNYID
WIDKQKKEFEKQKKKYNGEILAYTTPGSELPNGVKNMYYKDFYTEFKRTYENIHEFLNLL
NKETKCINIEKTDEESKIDFNDSEKTFSASKYCKPCPECGVKKENGEFKVRGPKEKECQV
TNDNNTLIGTLTNINVLSSGDKREDIYKKLKNFCDKLDISQLTEKWKCYHLNNGKNKCLI
KNNVQNDKGYDELMDYYNFFHFWVSHMLKDSIEWRKELNKCIKTANKPTCMKWCINPCEC
FKRWIGKKEKEWREIKHHYEKQDGLPYGGHYAILEGVLVEQFFNDITEAYDDPNETERIK
KMLEKQNNQETDDTRKRKTIIDFLLDHEKDDANKCLKTHTGDKQCINEFHDDEEDEEPPT
PDIENPCAEPNGSNTKHRAIAHNVAYHIQKDAHAEASKRSLSLLKADALEGKYLGSGQER
KLKNICSITEDHSNCTKKLHEPCDGKDSKSDMFDITKGWKNGTFVNETHTHTYMPPRRQH
FCTSNLEYLQTKESPLNGSDYKLVNNSFLGDVLLSANKQVEWIKKKYKDQPHLKDNETMC
RAVKYSFADLGDIIKGTDLWDENEGEKRTQNTLKEIFDNIYNKNSDIQKIYNNIDDEKHL
HLREDWWEANRKDVWRAMQCGNDNPCSGESDHTPLDDYIPQRLRWMTEWAEWYCKVQKEA
YKTLERECKDCKEMGGQCKNGEDMCKKCTEACTEYNRKIEQWKKQWEQISGKYQILYLHA
QTDARNVGRSVSTGYEKDQHFLKFFKEIRKENYGKKTYETAEGYVHQEATMNCDTQTQFC
KKKHGVTQPTGTQEDDDYTFRENPKDHDGKCSCDKPQEKKFEVCNLVKDHFTQKENVKTG
EINGCNRKNSTNKWDCSQGSMNSENNGACMPPRRQSLCISNLRFSGETQDENKLREAFIK
CAAKEIHFAWDRYKNHNSGADEKLKRGEIPEEFKRQMYYTFGDYRDFLFGTDISKNNGNI
REVNQNINNLFKDKKGQENVQDNSERVSWWGKHGPDIWEAMLCGLTYDLTENEKKKIREK
SEYQYSDDIEKFAKKPQFLRWFTEWGEHFCREHKTQLESLKKKCPEDTCTNGDERKKQEC
TAACEDYKKWLKDWKENYKTQSEKYFNDKAGGKFQSTSANAEVNSSTNAYEYLNKVLQKI
CTDDYCKCMDAESNETSKKQQSESPGNCDSHDSHMPASLDDTPSEYKDRCDCKSEKMEKP
DPSLNCIDKSAFELYAKAQNDLNGMKDKLRGKNTKDIYEEKTNDTNGDNVICKIKENGST
QNNECNDSGNPFDDIDKWECTNPRNKVTNEDICIPPRRKYMCTKPLQNLETKTCTSLNEL
LNVVLRTAAYEGKHIKDSWDRTQNRKKRNQICDAMKYSFADLADIVRGTDKYKNTNGNSS
GSNSSKIEENLKTIFSNIQKTDENFQKKYTNLESFRSAWWDANREYVWKAMTCSAPEDAT
LFKKLENSEISNLVLSQHKCGYENDPPVDDYIPQPFRWMKEWSEHFCRVHKKHLDDLQKE
CGECNKNNSPCWKDRKGKSCRKCQEKCKAYNEMIEKWKAQWNDQQKNYNQLYFSRKNGNK
NGENHTAFIEKMKKECKNDHISADKFIEKASNCTNITFNEQKHDKSGQSSSTSSPYAFEL
PPKGYNVICGTTYRKSCLKLKRSNYGDTCPNKINLCGSNAVWKKLPHYNIYVPPRTQQLC
LEPLKTLISTTNKTTRVTEYDFSKTLQICAYNQAKSLHNYYSKDGKDFVFSVDTSEATED
EIKKQILESMKRSFADYGNLIKGRTQFEYNGIKKRLQDYVKTKLKYNGSDGKTTDDLWNK
HKSDIWHAMICAYNDSNQDKPLDEEDVMCKLPDNDTEDEFLRWFTEWGEDFCARKKKEIQ
IVNDACKFNNCEDANNESIRSCQKSCLKYKTWVQQKKIEYKNQTLKYNNYYKYSNQGKES
HIFLKDICKGKCACIEGNVNNDSIHNIFEEYPENVKMKCECQPDPCSGLSVTDSGFPDAS
PFGGGQPRSACPTRRGNHNKCPTEELCNFYNKKTKRCHVKTYDDYYSNWDSRGILKSSSK
NEGVLVPPRRRHICLRISTEHFLQLKNKPEDFERLIYSSAANEAKGLIKKYGNDNNKLLQ
AIKYSFADIGNVVKGDDMMQSPTSDYIGKIIGDKKGSKDKRIRWWNIHKKNVWDAMLCAY
KKATSNEISDPQWCSLPKEDETPQFLR
Download sequence
Identical sequences A0A024VXK0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]