SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VXL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VXL7
Domain Number 1 Region: 106-436,470-527
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.59e-76
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 518-761
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-33
Family Duffy binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VXL7
Sequence length 796
Comment (tr|A0A024VXL7|A0A024VXL7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW32980.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_06301 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPGSAGGDAEKYKNAQDAKHLFDIIGKDVYEQVKNGGAETYKDELKGNLTDSSILGRES
AYTTDPCKLIKEKRDKLLGTNSNRYPCKELSGKDAKKEERFSDTLGGQCTYNRIKGNKYN
KKTRKDCGACAPYRRLHLCSHNLETIETTNYDSNNAKHKLLLEVCMAAKYEGDLIKTHYT
PHQEKYKNTDTASQLCTVLARSFADIGDIVRGRDLYLGNPEEIKQRQQLDENLKTIFKNI
YEKLLEDNKTNGVKDRYEDNDGNYYQLREDWWDANRAKVWEAITCNDDDKLANASYFRKT
CSDEQGGAQANNKCRCKDKNGRPDDQVPTYFDYVPQYLRWFEEWAEDFCRKKKKKLEDVK
RNCRDDSKNLYCSGNGYDCTKTIYKKGKLVIGEHCTNCSVWCRLYEKWIDNQKKEFLKQK
EKYETEISNSGSCGGSGSAGGSRKKRAATTTNYDGYEKKFYEKLKEKNNYSDVKNFLELL
SKEEVCKKIKDKKEIIDFKTDDNDFHKNINNEGTFYHSQYCKPCPICGVKKTNNGGSGNK
WKEKDKSEECTSINLYKPKDNVNPTDVTILKSGDGQTEIAEKLKAFCDKKDSGNSDSSLY
DPWKCYKEDDIEKHADDDDDDGEYDRLVTGAGGLCILKNDKNKKEEKEKKTEKEPEQFQK
TYNDFFYFWIRRFLNDSMYWRGKVGGCLKNGTKTRCNKKNKCKDDCECFKRWIDIKIKEW
ENIKKHFKTQKGFELFPYDFVLKEVLKLDELFQNIKEGYGDVKELEGIENMLKEEQKKNK
EDEATGVTVGVVGVVL
Download sequence
Identical sequences A0A024VXL7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]