SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VXR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VXR9
Domain Number 1 Region: 96-379
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.22e-57
Family Duffy binding domain 0.00045
Further Details:      
 
Domain Number 2 Region: 375-518,551-571
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-26
Family Duffy binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024VXR9
Sequence length 690
Comment (tr|A0A024VXR9|A0A024VXR9_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW33464.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_05819 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAKGGPQGGKDKYDDAPDAKELLDRIGKDVHDQVQTDAKTYFSELKGDLSKASYPNDENS
EGSTENNPCKLQYDYNTNVTEGHGKEYPCANRSDIRFSDKQGAECDKSKIKDNKGKSEGA
CAPYRRSSLCDHHLSYMNAGKTNTTDNLLLRSSLCDHHLSYMNAGKTNTTDNLLLEVCLA
ALHEGDSLKHYSEKLNVTYTDSPSQLCTELARSFADIGDIIRGKDLYLGDKGEKKKLDDK
LKEIFENIRKENNSKLKSLTDDQIREYWWTANRHTVWEAITCDVHGSDYFRHTCNGQNKT
ESNCRCAAGDVPTYFDYVPQFLRWFEEWAEDFCRKKKKNIEIVKNFCRGVYEGKERYCDR
NGFDCERDSSLCEPWKCYKEDDIEKHVEHVLGYHKEVKGAGGLCILENKNKTSDNDPEEF
QKTFNDFFYFWVGRLLNDSIEWREKLGKCLENGTKTRCKNNKKCNRECGCFLKWIGQKKD
EWGKIKVHFGKQDFGEGKLFGPFPPYYVIETVLEDSFLDDITKAYGDARAIQGIKNMLAK
KKEEQNANTSNQKTIIDYLLDHEKKEAQECLRKHQEKCPEDTAGESRGRSADPSPGIPPA
PRPATTAATVESSTVEEDEEDEDEDDDDVDEGEEGETAKDTTEELPEVKKEEVKVCETVA
EALKGNLDYIYIFQHNTIIIILPYYNTPIT
Download sequence
Identical sequences A0A024VXR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]