SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VXX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VXX1
Domain Number 1 Region: 439-748,792-810
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.4e-74
Family Duffy binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 904-1070
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-36
Family Duffy binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 139-361
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.14e-30
Family Duffy binding domain 0.0038
Further Details:      
 
Domain Number 4 Region: 10-120
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000000116
Family Duffy binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VXX1
Sequence length 1071
Comment (tr|A0A024VXX1|A0A024VXX1_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW32756.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_06524 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
WKKDIEFREHYCTGCFSACSLYKIWIGKQKEEFLKQKKKYENEIQKYVSKKVKTNSTINN
EYYNVYKNFNEKNYETNNNFLNFLKEGKYCKESVKDENTIDFNSGVDNTFSDSKHCKVCP
YCGLDCDGTKCKPKPEIYTNCVNKDTYDPPDDAESTDINVIDSGNAVNISEKLNDFCTNP
TNPNDKIYQKWQCYYKSSKVNKCQMTSLTQTLQKHHYVMTFYIFFDLWVKNLLKDTMKWE
NEIKDCINNTNVTDCNNKCNKNCVCFDKWVKQKKKEWDIIKKLFKTEKDEMKNYYININK
NFELFFFRVMYELNNEEEKWNKLIENLRTKIDSSRRNTGNEDSEGVIKVLFEHLKEIAEK
CTHNNSNESCETSTNRTPNPCANTTGAVRLAKSVEQLASEMQTKAKAQLGSGSDKGESAL
KGKAEKGDYSRGGSGDDFKNNLCGITQKHSNAIGASNNPCNGKDNNKLRFKVGTTWKSGQ
SVSTSTDVYLPPRREHFCTSNLEYINISKVKDGNSLLGDVLLSAKYQAEHTMNDYKLEND
IEGKCRAVRRSFADIGDIIKGTDLWDQNNGEQKTQRRLDTVFGIIKKQFNGKYTNDSKHT
QLRKDWWEANRDQIWKAMQCPSTTTPHVTTNCDKEPTPLDDYIPQRLRWMTEWAEWYCKY
QSQEYEKLKRGCEGCTSAKCETETKCKVCKAKCQEYEQKIIPWKQQWETISKKYDDLYQK
AKQNDDTSSNKDADVVKFLSELYKTNNGKSDANSDVYSTAARYVHQELPNMGCNVQIQFC
KHKNGSTSSGKDNDKEYAFREKPHDHDDKCDCTDKSTPPLRRLLRLPRYLIRRRFRRHRR
RRPPQNVVVGGAGRILPAPEKPIEEEESDEEDPSDSEEDHVNTENNDQVEVMEETVAEVT
DIQKAGQTPPAPPVVDVCKIVDGILNGKSATDYIDGCNKKSYNGWNCKPSDVHSDHAGAC
MPPRRQKLCIYYFGNNTQIPIINSQDILKEAFIKSAAGETFLSWQKYKTDNNGGADLQIK
LESGIIPEDFKRKMFYTFGDLRDFLFGTDISKKHGEKSELKNKIDFLFENT
Download sequence
Identical sequences A0A024VXX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]