SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VYZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VYZ7
Domain Number 1 Region: 638-971,1021-1039
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.92e-78
Family Duffy binding domain 0.0000982
Further Details:      
 
Domain Number 2 Region: 1092-1414
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-71
Family Duffy binding domain 0.00013
Further Details:      
 
Domain Number 3 Region: 350-491,544-564
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.1e-36
Family Duffy binding domain 0.0075
Further Details:      
 
Domain Number 4 Region: 8-180,208-228
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-31
Family Duffy binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1465-1518,1550-1562
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.000000955
Family Duffy binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024VYZ7
Sequence length 1562
Comment (tr|A0A024VYZ7|A0A024VYZ7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW33470.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_05812 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MTPSHCRCGDDKKPDKSKAGNGEVNIVPTYFDYVPQFLRWFEEWAEDFCRLRKHKLKDAI
QKCREKDKGDKKLYCDLNRHDCAQTIRGDHVFVEEDVCKYCHFSCSHFVKWIDNQKLEFE
KQKNKYTKEITGGGRSRNRKKRSATTMVYGEYERKFYDKFKTDYVDVDKFLEKLNDEEVC
KKKLKDVDDKGGKIDFKTVNSSSAKNSGGDDSNKTFSHTEYCQACPWCGAEKDNSRNGNW
TPKGDKTCGEGKEYGDYKFTNIPILTPQEQSDIFQKYKSFCESVKDTANGGGGSGPGGGG
AGTSGGASGTGGGGSGGGSGGVANSTIPGTVNGGAPGEKGGKSATGGVSQIKTWKCYYDE
NKNNNDGKKDINFCVLQDGKQHTKDQKDKSYNAFFWDWVHDMLIDSIKWRNEHGKCINKD
NGKTCKRGCNTKCDCFLKWVKRKEKEWKQIIDHFYKQKGFDKKGENGIRGGGGLGMTADV
VLELLLDKDELLEIIEDTYGKSKETEHIKEMLEKEKKNKEAAATGAIAGGGVAASGSGTG
GANGKNTSIDKLLQHEEEIATKCKNCQPTKIRNPCSGDKTGDQRYEAVAQTVAKILQQKA
HTDMLQRSGKDGESETDQKVSLLKGEIKNAKLKNRAIQSGLNSECEITKDHSSANSPSNN
PCNGKGDGLQIGETWEQKHSRDTTNGEFYLPPRRQHMCTSNLENLNVSWVTEDGKAIHSL
LGDVLLAAKYQAQQIITKYKENEGKQGLTNPEDKKTVCRAMKYSFADIGDIIKGTDLWDE
DGGEKTTQNKLKTVFDNIYNSLDEEIQKRYTNRENKHLDLRKDWWEANRKDVWKAMQCSK
NNDGIYCGATPHDDYIPQRLRWMTEWAEWFCKEQYSLYDKLFMQCAGCKNKEDGKGCTQG
DNDCTPCAEACKAYRDKIKTWENQWKQLKAKYEELYLYAKNYSTRMVLLGTDPDYQQMVE
FFKELQKVTGDTTRATTSTTITPYSSPEGYIHQELPITGCQIQKEFCYYKNGLTSHSSDA
KENKNYAFKNPPHGYDKACKCDTRDQQTDGDPGARSGPGSSDTPPRSEKGDSASDEGEDD
DEEEEDEEDEEEEEDDKVCGMVKALIRDNDGKQPIENCNPKEYNNQAYPEWKCDKNSKLV
SGDGECMPPRRQKLCLYYLTQLGDKVNEDEFKTAFIKTAAAETFHAWHYYKSKNSDKAKQ
LDNGTIPEEFLRSMFFTYGDYRDICLNSDISIKDGQVKDAIDNIGKFFSKDGSKSPSCLS
RQEWWKKNGTEIWEGMLCALPGTGNLQNNPDYNNPPEDFAKKPQFLRWMIEWGEEFCRER
EKLEQNIGKSCSGEPSGDGCKEGTPCKNACQKYEQYVKKKKDEFYKQTTKFVQKANETSP
DPEYKGYGYIEGKDGVQPIQGNEYLLKNCDTGKCDCMKGNVLGFVTDVKPFGIYAHNHSD
KCNCLQGKHSRSSQPSPPPAQPPAQPPPPPVIPAPTVDVCTTVKNALEGKLDDACTLKYG
TPNRYWGWKCIPSGTTSGDQKATSGETGLRRNRRDTSGVTTTGSSGDTTGGLCIPPRRRR
LY
Download sequence
Identical sequences A0A024VYZ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]