SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VZ28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VZ28
Domain Number 1 Region: 2-194
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.78e-59
Family Glutathione peroxidase-like 0.0000000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024VZ28
Sequence length 195
Comment (tr|A0A024VZ28|A0A024VZ28_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW33904.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_05358 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MASYVGREAPYFKAEAVFADNTFGEVNLHDFIGKKYVLLYFYPLDFTFVCPSEIIALDKA
LDAFKERNVELIGCSVDSKYTHLAWKKTPLTKGGIGNIQHTLISDITKSISRSYNVLFGD
SVSLRAFVLIDKQGVVQHLLVNNLAIGRSVEEVLRIIDAVQHHEQHGDVCPANWKKGKVA
MKPSEEGVSEYLSKL
Download sequence
Identical sequences A0A024V058 A0A024VZ28 A0A024WGD8 A0A024WZM5 A0A0L7K644 A0A0L7M1G7 Q8IL80 Q9N699 W4IA13 W4IXF8 W7F7C6 W7FPU2 W7JQN9 W7K747
PF14_0368 XP_001348542.1.26446 PFDG_02440T0 PFHG_00298T0 gi|124809308|ref|XP_001348542.1| gi|23497438|gb|AAN36981.1| 5833.PF14_0368-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]