SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VZZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VZZ8
Domain Number 1 Region: 178-459
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-50
Family Duffy binding domain 0.0000916
Further Details:      
 
Domain Number 2 Region: 1-98,127-146
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.49e-19
Family Duffy binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VZZ8
Sequence length 529
Comment (tr|A0A024VZZ8|A0A024VZZ8_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW33461.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_05821 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MTEWSEYFCKAMNKNIDEMKVECDKCTSGKCSNDTEGKFCIRCKEKCKSYSEFINKWKEQ
LETQSKSYKKLYEMSETYSSFSEDVKLFVKKLKENQKDCSVKNAFEYIHKTSNCVNYKFN
ENDGSSNKRTYAFEETPNSYKEACTCTSPTKNPLDDCPTDQTKDGCKELQSFTFCTKNDY
DNNLDNWNSHLVLNSSDDNKGVLIPPRRRHLCTRPITRYIYRNDDKEIFKKHLLTSAFSQ
GQLLGQKYKSEKELCFEAMKYSFADYADIIKGTDMLDTTTSKKINKRLLELLNVSNNVRR
HATSWWENNRSHVWHAMLCGYQKAGGEIEKKDCELPNEDEIPQFLRWLIEWAKQACKEEQ
ILKNSFETKCNCTKIEEKAYSEILEKINCKGEIIKYINWINKVKLYYDGLNGKYQRFIKS
SATTKVKQTQPNAHDYIKVNYPECNFDFSKIYEIYNNNIQDNNVAFKEILKIFCPKLNFD
NDVIPEQITEKKETLPLPSQYDSTNDILTNTIPFGIALALCSVAFLFMK
Download sequence
Identical sequences A0A024VZZ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]