SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WAR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WAR2
Domain Number 1 Region: 368-711
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.29e-72
Family Duffy binding domain 0.0000436
Further Details:      
 
Domain Number 2 Region: 845-1154,1183-1202
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.49e-63
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 3 Region: 2-269
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.98e-48
Family Duffy binding domain 0.0003
Further Details:      
 
Domain Number 4 Region: 1209-1430
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.49e-47
Family Duffy binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024WAR2
Sequence length 1824
Comment (tr|A0A024WAR2|A0A024WAR2_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW37994.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_01304 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MEVAATEGYNLGQYYKEKKKANKEAYRYSYEVRPYSAMKYSFYDLRDIILGYDNLEDNST
TTEKNLKEIFKNESKEDSQGRQTFWNNNKDCVWEAMKCGYNKSGETIPDECKNMPRDSDY
PIGSNRDEGTEYQFLRWFAEWGEDFCKHKEKELKKLVGACNDYNCGDNEDKKKKCTSACT
QYKQFISEWKPQYENQIKKYGKHKHKIYSEHPVAKEAKDAQEYLDKQLQKSCNSGGKCDC
MNKKSMSNRNNMPASLDDTPSEYKKKCNCPLPPKKPEAPLARAAAPPASTTKNPPSRKTQ
PSQAAREMQADESASPSPRVSLISKATASKKEAKTAPPTKQPKKVEKPTTEMRARKRTRR
AAQQARTRTSTPTTTASDVATMVKAILSNEPDSRGGIEGCNPKTNGPYPEWDCNVGKSKE
NINGACMPPRRIKLCINNIQYLNNDFENKPEKDIKEAFIKCAAIEIYFWWLKYKRENPTA
ENELKNGRIPDEFKRIMYYTYGDYKDIFFGTDISNDKRIITIINSVTTILKNENNKKKED
KKKKDEELRKIFWEENKKYIWEGMLYGLTHHLTDETEKKKITDNSEYKDITKLTPSLEEF
AKRPQFLRWFTEWAEDFCNQRKKQLKKLEAGCKEYECNGSDERKTQECAEACETYQKFIK
KWKNEYERQREKFKRDKDNEKYKDYPSTERDIEKATYAHEYLNMKLKEFCGNKDCSCMQK
PSSQLPKTKSPSQPSDGNDMPESLDNHPEEFNKCECPEISKNESKTHTKKIPAPKIPMNC
VEKAAYYLSKEAENNIERTLKPKVTHSNCVKETDNSFSSNNRCDPNKPYAPDKYIGRRNP
CENREENRFKLDSEWKCYKNIKLYQEKKRVCIPPRRENMCISNLDEIEIAKVNQSNYLLN
MVRIAARNEGIDIIKNFNSENGCAMNPICDTMKYSFADLGDIVRGTDMLRIGGYLPPVEI
KLYKAFEYIYGKWRNKNKGRNKYNDVQTFRSAWWDANRKDIWKAMTCKAPEDAKLFRKGR
MDGFESITLIQDKCGHKDDPPVDDYIPQRFRWMTEWSEYYCKALKVELEKLEKLEKSCDH
CKTTNKCKNDYDKNKCEKCKTRCQQYDNFILKWKTLFDIQSKKYKELYEPIDTKNSTYDH
VENFVQKLKKYKNECSVESVSEYLHETSKCLNYKFDENDGSSNIRSYAFEETPKSYKEAC
SCTLPSKNPLDNCPTDQNKDVCKELQTFTFCSKNDYDNNPDNWNAYLVLNSSDDNKGVLI
PPRRRHLCTRPITAYNYRKGDKEILKKKLLTSAFSQGQLLGQKYKAEKELCFEAMKYSYA
DYSDIIKGTDMMDTSLSEKIKKIFEISNEATEDRKTWWENNRSHVWHSMLCGYKIATSNV
TLDEEWCQLPKDEETNQFLRWLIEWAKQACKEKKHITNSLKTKCRCSNKDNFKASELLRQ
PGCSFYQAPLFSTHRVAQYDPKNDILKSSISVVIVSALELDINDIYVPGSPKYKTLIEVV
LEPSKRDISSDDIPSDDTPSNDTPRTNRFIDDEWNELKHDFVSQYLPNTEPNNNYRSADI
PMNTEPNTLYFDNPEEKPFIISIHDRDLYTGKEISYNINMSTNTNNDIPMNARNDSYRGI
DLINDSLSGAKPIDIYDEVLKRKENELFGTKHPKRWKKDNDGGNVPIDNRTLNTDVSIQI
DMDHGKPKKEFTNMDTNVDTPTMDSILYDLERHNEPFYDIYDDDVYYDVNDDNKTSAHHN
NLDVSSKVQIEMDVNTKLAKEKYPISDLKLFKLKNINYWKKIEYNNILLFALLLLILLLI
VILLEVVISSITINFISDNTTLKI
Download sequence
Identical sequences A0A024WAR2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]