SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WCQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WCQ1
Domain Number 1 Region: 182-459
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.01e-56
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 1-105,133-152
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-16
Family Duffy binding domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024WCQ1
Sequence length 560
Comment (tr|A0A024WCQ1|A0A024WCQ1_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW37991.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_01307 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MTEWSEYFCKALNKKLETFKTVCDECIQSEKKCHDNNKGKECEKCKEKCSKYKDFVNKWK
DQYDLQAKAYEELYDKANKNTNIYVTNDDNFAVEFLKDVKSVCTKNDPSSAEKYLYKTSN
CKQYKFKDESTHPIKIYSFKEYPEGYENHCTCEITQHPLDDCPDDTNKEVCSRFQVVKRC
MKKDFNNDLDNWNSYGVEDFKGKNAGVLVPPRRRHLCLYNTIINLPSMVHKNDFKKVFLN
AVYTEGKLLWDKYGENSNDVMEAMKYSFADYADIIKGTDMLDTTTSKKINKRLLELLNVS
NNDRRHATSWWKNNRSHIWHAMLCGYKKANDKFVINSDTCKLPNEDEIPQFLRWLLEWAK
QACKEKKIRKQALQTKCYCSNPNEISGSDIIKHYPCKSELTKYIQWNLMIKELLDQLNIK
YQNIKASNNPKNPSEINAEEYIETELKEGECNLVDIERIYNKIKQEHNPLKEILMYLCPN
LEFPDDTFEYIGKTETEDTTIEPETPTSDNPEDSIPSISPEDVHPTTGEDTNIFNSNILS
STIPFGIALALSSIAFLFLK
Download sequence
Identical sequences A0A024WCQ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]