SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WF37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WF37
Domain Number 1 Region: 589-884
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-57
Family Duffy binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 253-534,565-582
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-54
Family Duffy binding domain 0.0000433
Further Details:      
 
Domain Number 3 Region: 35-141
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000000000000157
Family Duffy binding domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024WF37
Sequence length 1229
Comment (tr|A0A024WF37|A0A024WF37_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW39125.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_00168 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKSGVRKAIYEEKEKKKQNENFPPCMGVEHIGIAKPQFIRWLEEWTNEFCEKYTKYFGAI
NSKCDPRKGADDCDDNSNIECKRACANYTNWLNPKRIEWNGMSNYYNKIYRKSNKESEDG
KDYSMIMEPTVIDYLNKRCHGEINGNYICCSCKNIGAYNTTSGTVNKKLQKKETECEDNK
GPLDLMNEVLNKMDEKYSEHKMKCTEVYLEHVEEQLKEIDNAIKDYKLYPLDRCFDDQTK
MKVCDLIRDAIGCKDKTKLDELDEWNDMDLRDPYNKHKGVLIPPRRRQLCFSRIVRGPAN
LRSLNEFKEEILKGAQSEGKFLGNYYNEDKDKEKKEHKDKEKALEAMKNSFYDYEYIIKG
SDILENIQFKDIKRKLDKLLTKETNNNTKKVDDWWETNKKSIWNAMLCGYKKSGNKIIDP
SWCTIPTTEKTPQFLRWIKEWGTNVCIQKEKYKKNVKSECSNVPNNNLGAQESESKNCIS
EIKKYQEWSRKRSIQWEAISKRYKRMDEFKNTFKNIKEPDANEYLKEHCSKCPCGFNDME
EITKYTNIGNEAFNTIIEKVKIPAELEDVIYRLKHHEYDKGNDYICNKYKNINVNMKKNN
DDTWTDLVKNSSDINKGVLIPPRRKNLFLKIDQSDICKYKKNPKLFNDFIYSSAFTEVER
LKKVYGEARAKVAHSMKYSFADIGNIIKGDDMMENNSSDKIGKILGDGVGQNEKRKKWWD
MNKYHVWEAMLCGYKHAYGNISHDDKKKLDIPNNDNEHQFLRWFTEWSEDFCNNRYKELE
KLKMSCPHNVCFLDEGTEKKCMEACDKYKSYVLSKKKEYEIQKKKYDTEFKNQNGNQKDA
PDYIKDKCNNNCDCISYHIDDKKNWKEPYDTFDDDKFKGKCDCPKPLPLFSDNTSDILQK
TIPFGVALALGSIAFLFMKYACLDTYTLPKYKTLIEVVLEPSKRDTFNTSSGDTFTNKLT
DDEWNQLKQDFIEQYLQNIQKDFILHDSVNEKPFITQIQDRFLDSSHEEVIYNIDWNVPE
NINRITNNMDDPKYSSNNLYTGTDLINDSLNGNQYIDIYDEMLKRKENELFGTYHTKYTT
FNSVSKQTPSDPIINQLDLYHNWMDKHRDICEQWKTKEDMLYKLNEVWNMERKEYLLDIQ
PSTLDDIHKINDETYNIISTNNIYDHPSQETPLQLLGSTNIIPSYITTEQNNGLRTNISM
DTYIDETNNNNVVATSIIGDDQMENSYNC
Download sequence
Identical sequences A0A024WF37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]