SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WFD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WFD4
Domain Number 1 Region: 412-729
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.46e-49
Family Duffy binding domain 0.0000259
Further Details:      
 
Domain Number 2 Region: 129-403
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-48
Family Duffy binding domain 0.000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024WFD4
Sequence length 828
Comment (tr|A0A024WFD4|A0A024WFD4_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW39251.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_00025 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKGKMNMCLFFFYSILYVVLCTYVLGISEEYLKERPQGLNVETNNNNNNNNNNNNNSNSN
DAMSFVNEVIRFIENEKDDKEDKKVKIISRPVENTLHRYPVSSFLNIKKYGRKGEYLNRN
SFVQRSYIRGCKGKRSTHTWICENKGNNNICIPDRRVQLCITALQDLKNSGSETTDRKLL
RDKVFDSAMYETDLLWNKYGFRGFDDFCDDVKNSYLDYKDVIFGTDLDKNNISKLVEESL
KRFFKKDSSVLNPTAWWRRYGTRLWKTMIQPYAHLGCRKPDENEPQINRWILEWGKYNCR
LMKEKEKLLTGECSVNRKKSDCSTGCNNECYTYRSLINRQRYEVSILGKKYIKVVRYTIF
RRKIVQPDNALDFLKLNCSECKDIDFKPFFEFEYGKYEEKCMCQSYIDLKIQFKNNDICS
FNAQTDTVSSDKRFCLEKKEFKPWQCDKNSFETVHHKGVCVSPRRQGFCLGNLNYLLNDD
IYNVHNSQLLIEIIMASKQEGKLLWKKHGTILDNQNACKYINDSYVDYKDIVIGNDLWND
NNSIKVQNNLNLIFERNFGYKVGRNKLFKTIKELKNVWWILNRNKVWESMRCGIDEVDQR
RKTCERIDELENMPQFFRWFSQWAHFFCKEKEYWELKLNDKCTGNNGKSLCQDKTCQNVC
TNMNYWTYTRKLAYEIQSVKYDKDRKLFSLAKDKNVTTFLKENAKNCSNIDFTKIFDQLD
KLFKERCSCMDTQVLEVKNKEMLSIDSNSEDATDISEKNGEEELYVNHNSVSVASGNKEI
EKSKDEKQPEKEAKQTNGTLTVRTDKDSDRNKGKDTATDTKNSPENLK
Download sequence
Identical sequences A0A024WFD4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]