SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WFE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WFE7
Domain Number 1 Region: 713-819,850-926,965-1134
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.22e-77
Family Duffy binding domain 0.00077
Further Details:      
 
Domain Number 2 Region: 1904-2251
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-63
Family Duffy binding domain 0.0000793
Further Details:      
 
Domain Number 3 Region: 97-372
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-47
Family Duffy binding domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1468-1781
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.81e-42
Family Duffy binding domain 0.00034
Further Details:      
 
Domain Number 5 Region: 1173-1346
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.03e-34
Family Duffy binding domain 0.011
Further Details:      
 
Domain Number 6 Region: 397-426,480-598,642-662
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-32
Family Duffy binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024WFE7
Sequence length 2539
Comment (tr|A0A024WFE7|A0A024WFE7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW45664.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_06277 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPGNAGGGNDYSDAKHLLDSIGKEVHDKVKNGGADAKKYIEELKGQLSFATLLGVESAS
SPNPCNLESEYTKLINGSGSGSGVAARIFGHIYEELKKDRKNWAKELQKRYNGDEDKNFF
QLREDWWYANRETVWKAITCDAPTDAQYFGAPCDRDDNEKHSTLTKGYCRCKGDQPGQDR
PNTDPPTYFDYVPQYLRWFEEWAEDFCTKRKHKLKDAIKKCRGDSGKEKYCSGNGLDCTK
TVRGDLHFVVGDCRDCLVACSPFVKWLDNQKQEFEKQKEKYADEIKKANGKTTKETSNGP
INNLYVKEFYEKLEKQYKSVQTFLGLLNKETTCKEHPEVEVKGKKADHVDFKNHEDNETF
CRTEYCKPCPWCGAEQESGGGWKAKTETCGKIMVHNPDNITKIPVLTPEKGKFGIYRKYK
RFCESVKDTVNGGGGGSDGAGGGASGARGKGASGGVANRTAPGTAKDVAIDKKGGKSANG
KNGNQIVTWQCYYDKDKRSGQNDNCVEVTRDKFTQGKKVKPYYAFFWDWVYHMLHDSLEW
RKQLGRCINKKEETKCIGSCKKKCDCYKKWVEHMRTEWEQIEKHFDKQGDLQGSERNTTL
KLIFQLFFMDKIKEAYGENKLNELKQKLERNGRQKVAGDTQDSEDAIKFLLKHELEEAEK
CLKTHNEKKCEEQATRARGRADHHDDQEPQVEQSSDDEEEEEEENEDDVEEPEAEPPPKK
EEPACEIVKKLFENEASKDYTDWCTQKYSGKNSYRSWDCRQSTFKKEHQGACMPPRRKYL
YIHKLKNLNSDKTSTDIELRKAFIECAAIETFFSWHEFKKDKEREEKEQQSLLVYAPHVE
EQLQKDLENGTIPEEFKRQMFYTFGDYRDLCLGNDIGKAADTTGISDKVKSILSGKTPNG
EECETWWNTNAAAIWDGMICALSYDTNDKNVIEGLRDRLIKPDKKNDYDKVKISSVTSNN
DPSGDTLLSDFVKRPTFFRWLEEWAEEFFRKRTYTLKRIEDECRGNNYSKYCDGDGFDCT
EIGPNMNETITTFNCPTCGKYCRFYKHWINRKKDEFEKQEKKYQNKIDDAEGNSAVIYHK
EFYTTLKAQYPTVKQFLKTLKDGPFSNNNIGDNEIDFNKPNLTFGPAENCAPCPIFGVER
IKGVLSKITEKTCGKGTFKDTFDIKNMENPTGKGNILVIDNSTKVFEGDLEVCNGTDIVK
GIRKDEWSCGYVFGYDVCELKTFKRDINDKQNIKIRTLFKIWIEIFLKDYNKIKEYLNRC
MNNGRASICSNKCGKNCECIEKWAKEKMTEWKKVRELYFKQYRDDNIDEVYEVRRFLGDL
KPQTEVKKAIEPFENLDNLQYSSVCTDSNRSEKGQTKYNDVVVCLLDKLKRDIKTCKKNP
HTTTKSCTETLPEPPSSHDDSPYTEEPDDNHDQYTQQPKFCPKVDTPEKTKTVHDILCNN
QRVEPCNSLKKYHSTIWDKGSTSTNRLCNKNNLVGIGAKWTKFSNDNGNIYVSPRTKQLC
LTPIMKVNSTSNKQIYIQNLQKSAFLEAKGLYEYYKKNQKKFGSKNGVSTDDDIKNNTLQ
AMRRSYADYSDLIKGNSVYDYNTMKNQVAEDLKILQYKDNANGKTPENFWDEYKTDIWHS
MLCGYNAANTNNPLHENDDICKLPTTDNDNQLLRWFVEWGEDFCFTSKNRLENMREMCSG
NVCKDSKGYSAIKQKCNAACEKYTAYIKEKKTEYDEEKANLVHIKEKLNDAQSKDILEHF
KAKCTEKCKCITEIFTNKDNWDNPMDNIDTENFELKKKCECSKHPGEYKDTCDGLSISGS
GFPDGSAFGGGISNGKCNAFLGGEITEPAKPNTTNNCIENIANKLQKTEKQKLNHIVSFF
NLKGVIKQDITKSSQHLPCDICKPNECLLSGNNKIFCNNNINVFDEKEWDCNKENNNLLE
DGLCLPPRRKYMCTKYLEELDTEKVNTTNTLLKKVLVTAFYEGKQLKEQWDKIPMHSKKN
KLCDIMKYSFADLGDIIRGKDKWNGTNGDNIIEKNLKTVFEKIYQENNVKQIYPNDASAN
YWKLREAWWYANRKEVWKAMTCSAPDEAEVHKKINNYGIENLTQILSKCGHKHDPPNYDY
IPQRLRWMTEWGESFCEILYKKFHEMKTQCSECKQNINSCVSGQEMCIQCDNSCKDYKNL
VEKWKSVFMIQKNKYSHLYEEANGNETNTKDELTKFLRNVNTECNETKTAEEYLDKSTKC
SYYKFNNNDKLQIEYVFKDIPKIFEKACKCKESSPRSDDSSETRTPKEDSSPPIVSPTDV
NEEQSIPINDILSSTIPLGVALALGSIAFLFLKKKTKSSVVNLFQILQIPKSDYDIPTKL
SPNRYIPYTSGKYRGKRYIYLEGDSGTDSGYTDHYSDITSSESEYEELDINDIYVPGSPK
YKTLIEVVLEPSGKNTTASGNNTTASGNNTTASDTQNDIQNDGIPSSKITDNEWNTLKDE
FISNMLQNEPKDVPNDYSSGDIPMNTQPNTLYFDNNQEKPFITSIHDRNLYTGEENSYNI
NMSTNSMDDPKYVSNNVYS
Download sequence
Identical sequences A0A024WFE7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]