SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WFM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WFM7
Domain Number 1 Region: 538-822
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.4e-61
Family Duffy binding domain 0.00000268
Further Details:      
 
Domain Number 2 Region: 221-503
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.58e-46
Family Duffy binding domain 0.00000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024WFM7
Sequence length 2654
Comment (tr|A0A024WFM7|A0A024WFM7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW45849.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_06095 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNVPLNIKFLFFLFCLHCVSSKDQTSEKVKSQKENDSLQVHKKKSGELNNNKSGILRSTY
KRIVGYTQKKLEDLFHVNGEYIKKEEDEKEKVDQNKDMLKSGLMIIDQNKDGEELENLID
PIKNIKDSNNLENYYDDNYNNIKFDVGNKSNHLKYMKTRNSDSDERFSNYYFIDNNLFLR
DNKEQDENVFLSKSIIRNKDVDISIKDFEKNKFIDTYSLYECGKKIKEMKWICTDNQFKS
NNLCAPIRRIQLCIVNIILFSENENEYIYKNDSINNKFKENILKAVKLESNLLVQKHNNE
YNSKLCDDIRWSFLDYGDIIIGRDLIYKNNTDYIKEQFKKIFNNEYNNNELNDELNNELN
DEKNIKLRKEWWEKYKEDIWEEMTKEHNDKFIEKCKYFAKDEPQIVRWIEEWSKQFLDEK
NYMLFTLRNTYNEMNIIHENNCKQYNKWVQNRKKEWTFLSNEFNKIFPERNVQIHISNIF
KEYKENNVDIIFGTLNYEYNNFCKEKPELVSAAKYNLKAPNAKSPRIYKSKEHEESSVFG
CKTKISKVKKKWNCYSNNKVTKPEGVCGPPRRQQLCLGYIFLIRDGNEEGLKDHINKAAN
YEAMHLKEKYENAGGDKICNAILGSYADIGDIVRGLDVWRDINTNKLSENFQKIFMGGGN
SRKKQNDNNERNKWWEKQRNLIWSSMVKHIPKGKTCKRHNNFEKIPQFLRWLKEWGDEFC
EEMGTEVKQLEKICENKNCSEKKCKNACSSYEKWIKERKNEYNLQSKKFDSDKKLNKKNN
LYNKFEDSKAYLRSESKQCSNIEFNDETFTFPNKYKEACMVCENPSSSKALKPIKTNVFP
IEESKKSELSSLTDKSKNTPNSSGGGNYGDRQISKRDDVHHDGPKEVKSGEKEVPKIDAA
VKTENEFTSNRNDIEGKEKSKGDHSSPVHSKDIKNEEPQRVVSENLPKIEEKMESSDSIP
ITHIEAEKGQSSNSSDNDPAVVSGRESKDVNLHTSERIKENEEGVIKTDDSSKSIEISKI
PSDQNNHSDLSQNANEDSNQGNKETINPPSTEKNLKEIHYKTSDSDDHGSKIKSEIEPKE
LTEESPLTDKKTESAAIGDKNHESVKSADIFQSEIHNSDNRDRIVSESVVQDSSGSSMST
ESIRTDNKDFKTSEDIAPSINGHEKIGSSADDRGSEDKSIIDKDSENFENNKSSHSDIKQ
SDNEGSTDYESLTEESPKGDLESVSPSSIDMDLKPNKSSPVTSFDHVDSPNISELQSAKK
EKISVSPPNVSVTYDEGDKRQGISDDSSIHHEIDPEKNLHYESFISEGGLEEGDIEKEKG
KEDGSLIPISPEKINDFGKRENIVDPSVSERVDDNRSDISNVVSEEQESSIISSRNGTEG
INNSEELKSEEHTSVDVNNRDEHNKQENLVSSSTQQESEREKREKKENADSSHESELSSI
SEVGETIRRNDAEASENDKGEDILQSEEQQIVTEKTKLIEPTVNILQPSTPLGESHKEKS
EEIDDKDNTGGEVTHTDANTFQYRSSESVEVITNKPDEMEMTTKPPSQYIEKEIGEIDST
KNQDNDEQSNSIIPLINKNNEEDGVSIPSTRNVMESGSFVSRNEQIIEEKDDKHITDDTT
INPSENGLKGYGEMPNDSIKSVTITESPLRDVEQMIEPIDGKGNEKNNIIGEPQESTTEI
RKQMDGPISNVNIPEELHPVAEGSKLEEAKERSMDDADKGTITEDITVVEDPNGIGEHQN
LKEVHEQASELNTYNSLDGRTNVEVKERLDENPGSIPNDRITTEHIELDKEKEIHEPNEL
DAHNGEQEEMIRNEISDNRMDEQISRDNETRQLNQDHESDSKDEIIDKREMENLEENPNS
SSDSLENPEGKEKGKIEHTHSSEELDSVRDETYKYKGIENQITETEIESVEQQDTNIPGN
SKETEVDNSRADMEEEKDVKIKQIITEESEEELEISKDTTTSHSEKPNIEEQSVNIVDSK
NEINVQIEKNVQNEQNEGDPIILLEEQNKNIAILENQKNEYNNPSQLSHKERTLLEVDDL
EGSMDTDCLTSELNKNKCDSIQIIPEASNTDNKLNKDITENKDDFSEIEKSVGEIHENGK
DLLNKESAESDDVPVQNKIEHDSENAGVIDQYEYRTDYEENEKVNFVGLPGKPEEERSDV
TRGSVPGSVDAFEKKLHEPLDSNEKNKEELNVSKEIEYPVGLDILGIDSESSDSVTIYKK
PTDTFVENVHVLSRDIKSLFENEKTVGLNEQKKETEKNIAGGMIDVLNNKNIDDDQSVRL
STSLYHKGLDDDQSGRLSTALYDKGLDDDQHYLHDNSYNNNINNIKNEVQCKENCGRNEN
VSSFVDTTTLRDVKQNKEHTEETKLIENTKIDNTEVDDGVDITSDNRSSFISVDNYDEKK
KETIINEKKNDPKPSRKEEKDVKHDDSENDNNNLSSNIKIKERIENIYNYIKKLFNLTDI
NNYTEKKDMPRYNLNNFINTKSYTLFENSKESEYHGNELLQSENIPEHHNKSNNIKVSSN
LDNNYYRYVNKILEDIINLSKKKKKSINDTSFEYCESILRHSISSSSIYKDELKYLCFSI
LYYCLIYFDNTSEYYNCITNEFNNTLYIMFQTDMTNISYFNGKWILISEKDTLANNDVDF
MIKKNNDNYRSGNN
Download sequence
Identical sequences A0A024WFM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]