SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WFS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WFS8
Domain Number 1 Region: 55-488
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.42e-79
Family Duffy binding domain 0.00024
Further Details:      
 
Domain Number 2 Region: 481-687
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.79e-29
Family Duffy binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024WFS8
Sequence length 758
Comment (tr|A0A024WFS8|A0A024WFS8_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW45939.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_05996 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAAAAKVGGSPQDAKDAKELLDRIGEDIYKKIKDDSNVFRDYLKGNLASATNRSPELIDS
IDTCQLVKQYISHGGDAGGERYPCKKDRKGNEVPRFSNSVSGQCTNEKMRSGGKGACAPY
RRLHLCHHNLESIDTDKINSGNARHKLLAEVCYAAKYEGESLVKQYEEYIKKNRDFNICT
VLARSFADIGDIVRGRDLYLGNRKKKRNGKETERDKLQQNLKDIFKEIHGGLTTTNGKNG
KKSAKDHYKKDKETGNYYQLREDWWYANRETVWKALTCNAPEKAHYFKPSENNTQYFSNI
YCGGKQEGYVPTNLDYVPQFLRWFDEWSEDFCRLKKIKLDNVKNACRGDKNEKYCSYNGY
DCKKTNRSKNVCFWSSECTNCLVECKPYELWIVNQGKEFEKQKEKYEKEMNGNTSQKDST
NNNIHNKYNKDFYEILEEKGYKTVDKFINLLNKGRYCKKKKTDEEDIDFTKTGDRETFSR
SKYCQPCPYCGVDCSTGTCKENGNDDNCGKNVNSSAPLGGTSNEITVLYSDDKQGVITEK
LKDFCTETNNDKDENYQKWKCYNKNNDYNNCEMISSSYKNTKGTSVMLSVQCFYWWVQNL
LIDTIRWEYELKDCINNNYGTNCDNGCNKNCKCYEKWIKQKESEWKQVKNVFGNNNRMSY
IYYNNLSRIFDGFLFPVIYKLKEEEKEQWNQFTEDLKKKFESSKKSAGTGNSQDAIEFLL
DHLKDNATICKDNNTNEACPSTVDTTQNPCMKDTTTSG
Download sequence
Identical sequences A0A024WFS8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]