SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WFT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WFT2
Domain Number 1 Region: 232-570,620-638
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.5e-77
Family Duffy binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 706-835,878-974,1008-1051,1081-1184
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.05e-76
Family Duffy binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 1929-2228
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.16e-64
Family Duffy binding domain 0.0000523
Further Details:      
 
Domain Number 4 Region: 1518-1712,1740-1899
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.94e-61
Family Duffy binding domain 0.00026
Further Details:      
 
Domain Number 5 Region: 2-92,142-161
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.16e-26
Family Duffy binding domain 0.0037
Further Details:      
 
Domain Number 6 Region: 1177-1387
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.89e-26
Family Duffy binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024WFT2
Sequence length 2289
Comment (tr|A0A024WFT2|A0A024WFT2_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW45907.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_06029 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MHYNAFFRKWVYDMLHDSVEWRKQLGNCINDAKSQNCKNNKCNRECGCFEKWVEQKQQEW
KKIKEHFDKQKDLPPCLSHYKLLELLLEKKELLKSIKEAYGDTDDIKHIKQLLNDKAAVA
GVLGGGDASGPGGACTEGPVAEKDTTIDKLLKHEEGIAEKCVENNPPEKCQPKKLKNPCS
GDKKYDMLAEKVAETLQGKAQTQLDRNDSRNALRSDASKGQYNGRNSGNDLEENICSIDQ
TYSNAGNDESKNPCNGKGDGFKIGTEWPNIEGKKQTSYTDVYLPPRRQHMCTSNLEHLNT
GNNGLSNSSIASNSLLGDVLLAAKEEAEDIKNKAKGKDAKNGLTDDQTVCRAIRYSFADI
GDIIRGRDMWDKDKGARDMEDHLKKIFGKIKEEIKKKHLGIKGNDKYVKDNENKQLRSDW
WEANRDQIWKAMQCKTSPSVTTNCDKQPTPYDDYIPQRLRWMTEWAEWYCKEQSRLYGEL
MVACGRCKEKGSGKECMNGSVECKKCKPACEEYKKEIDKWKKQWEQMQIPYVILYYEAQR
NSDGMVLVGTYPDYKQVVEFFKKLKETIKSSALNRPKRSTDAITTDPTTPYSSAAGYIHQ
EARTGLCLEQREFCDKKNGIDNTSYAFKDPPHGYDKACKCDTRNQQTDGAPGRAEIPEDE
RTPRPDSDVEEEDESEASDEDDEDEDEGEEQPEPVENTEKEVPSPPKKEDTTSLDVCETV
KNALTIDTLKQACNLKYSGNNSRLGWKCIPSGNDKATGGAVTAPGDKGAICIPPRRRRLY
VGKLETLDTDSTSQNDVKTPSKPDKTASQDPSDKLREAFIQSAAIETFFLWDRYKKEWEQ
RNKSQNEVGGAAGGLQPPDGTLGDDKDKDPQKELQESGKIPDGFLRLMFYTLGDYRDILF
GDKEVIETLKKSGDKNIDKIEQKIKSVIEKSDSTSPRTPPVPPKTDSEKPRKTLWDRIAP
SIWKGMVCALSYDTTNISMNPEVHKHLTTNNNNNYKDVTISSVDPSGDTKLDDFAKRPTF
FRWLEEWGEEFCRKQRHKLKNLEKQCRGVNNSGNEKYCSGDGYHCNDDDLKHNKMFTRLN
CGDCEKECTNYRKWIQKKVQEFDKHKNKYGNEIEKLKTDSSKNAHDKMFYELINEKNNYT
CAEEFLASLNNCKNGEHDKNQTNKIDFKNLHKTFGPSTYCKACPIYGVNCDARGPSRGRS
ATNGCTKNTEPTNNEMHVVGDSTPIDILINDGATKETNNELQEKCKEYGLYKNLKKQKWK
CQNINNIYKCELQKPLNSEYYDDNIPFKILFERWLRDFVEGYNKSKERITRCTNDKTSCK
QGCKGNCVCVEEWLKIKEEEWNIIKQYYKQNFQSDDEPIDSNIKGFFEHGTFSSDAEEAK
KVVDEENKRDELWGCTGRNDCESKEEREKYGEFITNLIKKLKEKIGKCKTQHSDKTQPCD
EIPPHSDETLEEQTDDDTTDNQSPAFCPPPEPPMTCVEKIAKELRVEAEVNANKYDSSLK
GKGKDFKSECNKVKKENGTSQEDLCKFDKTYKNSLNNMDKQCELKGMDRLMLGKTWNSKY
ISKVGKVLYIPPRREHMCLDALNTLGRLTINDSSALLKKVQEAAKREGDDIIKKLLEQNS
CDEHRICDAMKYSFADIGDIIRGRDLLNKNNKQKGIQKKIENTFENIYIKLERDKSKYAN
DRQKYLKLRSDWWDANRKAIWNAMTCNAPKDAKLNKRNEEPEGTSTSGSFVSTLDNCGYE
KDPPDYDYIPQPFRWMQEWSEYYCKLLNKEMEQFENICAECKNNGVSCKDDINGNKCKKC
KEQCKNYNTLIHKSILEFDKYKETYNELYKNNTKAKISSEKHFKNFLEKLKDQCKDKNSA
DKYLDEASHCKKYKFTNSNNKNNDNYAFKNPPKDFEQACRCDAPDPLDECPNNKENKGAC
KKLSIENECKNKNLNNDDGWSAQEVKESTGKNNGVLVPPRRRHLCLRNITSNTKSINNKK
IFKNKLLKSAYSEGYYLWDKYKHDSTTLLDVMRYSFYDYGDIVKGTDMMDNYLLKQLKTT
IDQLLKDPHNDDASSYREKWWEANKTHVWHAMICGYQERNGYNSINASWCSVPTHDEKTH
QFLRWFREWTESFCIQRKKLYDIMVNNCKEAECDKNTGKVNLSECTQACREYENYVSKKK
NEYFSQKVKYDKDFKASNNKNDAPRYFKYSTYFNKYDCLYDHFNNDNNWKNPYDSFDDPK
HKEKCQCIQSIISIERKKKEEPKEPVQPPKKPEVEPPQADEPFNRDILEKTIPFGIALAL
GSIAFLFLK
Download sequence
Identical sequences A0A024WFT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]