SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WHU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WHU1
Domain Number 1 Region: 971-989,1024-1086,1127-1220,1275-1448
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-78
Family Duffy binding domain 0.0004
Further Details:      
 
Domain Number 2 Region: 417-753,780-798
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-76
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 3 Region: 16-203,235-359
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.54e-75
Family Duffy binding domain 0.00017
Further Details:      
 
Domain Number 4 Region: 1434-1665
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.14e-41
Family Duffy binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024WHU1
Sequence length 1872
Comment (tr|A0A024WHU1|A0A024WHU1_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW46096.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_05840 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MTIRINVIVRMIHDHKKKKKDDVCDMVKARIGNNDGTKKIEHCNPKGDPFIWDCNENKFE
RDHKGACMPPRRQKLCVIYLKYLSVTATETELRKAFIECAAVETFFLWHKYKTDNNGGAD
LQIKLEGGEIPEDFKRQMFYTFCDYRGLCLGKDIGNDVTDVQNNITAVFQKINRTTSEER
KNWWDTIKNDVWDGMLCALSYNTNEKQFKDEVRAKLMKPENNNTYPTVKFSEPSGATLPT
FAQTPQFLRWMTEWGDDFCKQRKGKVKELDEGCAGCKVSDNVNGESTKTCEKNSKECQKC
REACKEYQKWLQGWKDQYKKQSEKFTTDKEKTEYKDDSDVKNSTHAYEYLNKKLTNIKCT
SGTTNVDCNCMNEVSNKPYNDGSSETMPKSLVYPPNEINGKCDCKDPVPPPKKPEVPAVK
VQEACEIVEEMLTGKGATDDIQGCKKKDDGTNSYPPWKCDANMFEDNKDGPCMPPRRQKL
CVYFLRMLNNNKDKAKLKDGFIKCAAAETFLLWHKYKKDNNGGDAEEKLNSGIIPEEFKR
RMFYTFGDYRDLCLDTDISKKQGPVNDVKNKIDEIFPTTNPKNKTKRQEWWNENGPLIWH
GMLCALEKAWGKDTIKNKSNYNYHNVKFNGDKATLEEFAEIPQFLRWMIEWSEHFCKKQS
QEYNDLKDKCTGCTVGENGRVTNENCKNNCNACILRCKAYEAFITQWKVQWEKQRDKYTE
LYGKINNDSNHLTDQIEKSVFDYLKTLSSNGTTYSTAGKYINKKGYIQDCKEQKNFSNDD
GDNKYAFSNYPNDHEKRCTCKATPTKPEARRPPQPPPPPPEPARESGNDNRARSEDSEGQ
RPPPGPRPPPGPRPPPGPRPPPKEGVGRALKARGPDDVLSSSEDEEDDDDGGDQDAAKPE
TEEPEAETAAETAKEETKVDRKVDEEGEKAKKATEDKVDGGSPTTPAQDKVNPCDIVQTL
FSDTNKFKDVACNQKYGAPNRYWGWKCISDKTATTKPGAEPTRRVRSAETATGGKTTTSG
DTTGGSICVPPRRRRLYVKKLHDWASDETQSKSQETSEASSQSQKLREAFIQSAAVETFF
LWHRYKKLNTKSKETLGGGTRLLATLASGSVDGDSNDPKPEDELKRGDIPTDFLRQMFYT
LGDYRDICVGDNTDIVVNASSEDQKDKMKEIQKKIEQILPTSGSSPSPSDKNPKTWWNNN
AKDIWEGMICALTHKTDDPKVVDVKVKEKLLDKLKKDGDYNYEKVTLENSGTQPKPTYNS
PASGAKETSSAAPSENKPTTLTQFVKLPPFFRWLHEWGSDFCGKRARMLKNVKDNCTKDD
KKQYSGDGETCNEMLPADPTTLRDLGSSCPKYCRLYKKWIERKKDEYDKQQKAYDGQQKK
CVNGSNNDAKQFCGTLKSLSDAAAFLKTLKNGPCKTDNENGEGNEKDKLNFSKPNETFVP
AANCGPCSQFTVDCKNGNCRGSNGTTGNCNGGTITEQDIQNFGKFTDPVDMLVSDDNTNG
NKFDDLNDCDGADIFEGIKENKWECRKVCGYNVCKPKNVNGQNGDGNQILLFNALLKRWV
EYFLEDYKKIKHKISHCIKKGEPSNCINGCNKKCTCVEQWIQKKRAEWETIRGRFNDQYK
SNGSDDYNVRSFLETFLVQIGAANANNDGKKLIKLSQFDTSCGCSASVNEQNKNGYQDAI
ECMLNKLEDKAKNCKEKHQDSGENPENQCEQPPPLPDDNEEEYENENEKKVAQQAPAFCE
IQETKEDEEEKCDEKEEEEEKEEEKDKGDEEEEAEEEFFEEEAEEEEDDESDDEIHKDDS
YSDAEDEDEYEAVTESLSHSESRPKRLPREFPSTELKNAMLFSTILWMVGIGFAAFTYFF
LKKKKGKRNIGT
Download sequence
Identical sequences A0A024WHU1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]