SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WI29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WI29
Domain Number 1 Region: 1728-2004,2035-2050
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-54
Family Duffy binding domain 0.0000328
Further Details:      
 
Domain Number 2 Region: 2087-2358
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-53
Family Duffy binding domain 0.00017
Further Details:      
 
Domain Number 3 Region: 958-1288
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-52
Family Duffy binding domain 0.000097
Further Details:      
 
Domain Number 4 Region: 1279-1467,1501-1619
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.73e-50
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 5 Region: 258-547,586-602
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.28e-48
Family Duffy binding domain 0.00048
Further Details:      
 
Domain Number 6 Region: 2-109
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000000196
Family Duffy binding domain 0.0055
Further Details:      
 
Domain Number 7 Region: 736-868
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000000471
Family Duffy binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024WI29
Sequence length 2424
Comment (tr|A0A024WI29|A0A024WI29_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW46191.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_05745 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
TCKDKCKKYCECVKKWKSEWENQKNKYTELYEQENETSSSSKNTSRYDDYVKEFFKKLNE
VNYLSLENYIKGDPYFAEYATKLSFILNPSDANTSSEKIQKNNDEACNCNESGISSVGQA
PISDPSSNKTCNTHSSIKTNKKKVCKDVKLGINNNDKVLRVCVIEDDSLRGVDNCCFKDL
LGILQENCSDKNQSGSSSNGSCDKNSEEICQTKLEKVLASLTNCYKCDKCKSGTSRSRKI
WTWRKFRGNGEGLQKEYANTIGLSPRTQSLCLVVCLDEKEGKTQHKTISTNSELLKEWII
AAFHEGKNLKKRYPQNKNDDNGKKNDDNNSKLCKDLKYSFADYGDLIKGTSIWDNEYTKN
VELNLQKIFGKLFRKYIKKNISTEQDTSYSSLDELRESWWNTNKKYIWLAMKHGAEMNGT
TCSCSGDSSSGENQTNSCDDIPTIDLIPQYLRFLQEWVEHFCKQRQEKVKDVIENCNSCK
ECGGTCNGECKTECEKKCKNKCEAYKNFIEVCTGGDGTAGSSWVKRWDQIYMRYSKYIED
AKRNRKAGTKNCGTSSTTNVSVSAAENKCVQSDIDSFFKHLIDIGLTTPSSYLSIVLDEN
NCGDDKAPWTTYTTYTTYTTYTTYTTYTTYTTYTTYTTTKKCNKETDKSKSQSCNTAVVV
NVPSPLGNTPHGYKYACECRTPNKQETCDDRKEYMNQWIIDTSKNPKGSGSGKDYYELYT
YNGVQIKQAAGRSNNSKLDGNDVMFFNLFEQWNKEIQYQIEQYMTNTKISCNNEMKVLSR
VSEESKNQNSSDHPDGRNNNTDQGTNCKKNCECYELWIEKIKEQWETQKKNYNNFEKKTS
SYANNASHKKEIVKLSHFLFFSCWEEYIQKYFNGDWSKIKNIGSDTFEFLIKKCGNNSGD
GETIFSEKLNNAHIKCNENASKDTKINKSGKSSVLNATNYIRGCQSKTYDGKIFPGKGGE
KQWICKDTIIHGDTNGACIPPRTQNLCVGELWDKSYGGRSNIKNDTKESLKNKLKNAIQK
ETELLYEYHDKGTAIISQNDKKEKANNNNSNGLPKGFCHAVQRSFIDYKNMILGTSVNIY
EYIGKLQEDIKKIIEKGTTKQNGKTVGSGADKVNDWWKEIEKDMWGAVKCAITKINKKNN
KCTYTGNECGVSPPTGNDEDQSVSWFKEWGEQFCIERLGYEQNIREACTINGKNEKKCIN
SKSGQEDKIQGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKFASDLLKENYPECIS
ANFDFIFNDNIEYKTYYPYGDYNSICSCEQVKYYEYNKDEGQNNKSLCHEKGNDRTWSKK
YIKKLENGRTLEGIYVPPRRQQLCLYELFPIIIKNKNDITNAKKELLETLQIVAEREAYY
LWKQYNPTGKGIDDANKKACCAIRGSFYDLEDIIKGNDLVHDEYTKYIDSKLNKIFGSSN
TNNIDTKRARTDWWENETITNGPDNKTIRQLVWDAMQSGVRKAIYEEKEKKKQNENFPPC
MGVEHIGIAKPQFIRWLEEWTNEFCEKYTKYFEDMKSKCDPPKSADDCDDNSNIECKKAC
ANYTNWLNPKRIEWNGMSNYYNKIYRKSNKESEDGKDYSMIMEPTVIDYLNKRCNGEING
NYICCSCKNIGENSTSPAQKTKGSKKKDEQCEDNKGPLDLMNEVLNKMDEKYSAHKMKCT
EVYLEHVEEQLKEIDNAIKDYKLYPLDRCFDDKSKMKVCDLIRDAIGCKDKTKLDELDEW
NDVDMRGPYNKYKGVLIPPRRRQLCFSRIVRGPANLRNLNEFKEEILKGAQSEGKFLGNY
YNEDKDKEKALEAMKNSFYDYEYIIKGSDILENIQFKDIKRKLDKLLTKETNNNIQNAED
WWKVNNKSIWNAMLCGYKKSGNKIIDRSWCTIPTTEKTPQFLGWIKEWGTNVCIQKEKYK
KNVKSECSNVTNIDLDPQASESTKCTSEIKKYQEWSRKRSIQWEAISERYRKYKRMDEFK
NTFKNIKEPDANEYLKEHCSKCPCGYNDMQEITNDTENKQDIFNRIIEKVKIPAELEDVI
YRLKHHEYNSNDYFCRKYNNKNLYSRMQHNIDTIWTDNFVKNSSDINKGVLLPPRRKNLF
LKIDQSDICEYKKDPKLFNDFIYSSAFTEVERLKIVYGEAKAKVANAMKYSFADIGNIIK
GDDMMKSPTSKYIEQIFKGTEYSGIDRTKWWDMNKYHIWEAMLCGYQKGKNNTHSEKLDE
AWCDLPMEGDIPQFLRWFQEWTETFCVTRQELYDEVRTKCATAECTNGRINESECTQACV
NYKNYVLSKKTEYEIQKKKYDTEFKDKNGSPKDASQYFKDKCNNNCDCISYHIDDKENWK
YVYDTYDNKNLKAICDCPKPLPLFSDNTSDILQKTIPFGVALALGSIAFLFMKNNKNRKN
ENKNFYKIKNEKYHQRKKNNLLKN
Download sequence
Identical sequences A0A024WI29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]